SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000018937 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000018937
Domain Number 1 Region: 262-361
Classification Level Classification E-value
Superfamily Ubiquitin-like 8.44e-33
Family Ras-binding domain, RBD 0.0039
Further Details:      
 
Domain Number 2 Region: 395-501
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000000107
Family Pleckstrin-homology domain (PH domain) 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000018937   Gene: ENSCAFG00000012860   Transcript: ENSCAFT00000020408
Sequence length 644
Comment pep:known_by_projection chromosome:CanFam3.1:37:12286470:12380445:-1 gene:ENSCAFG00000012860 transcript:ENSCAFT00000020408 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEQLSDEEIDHGAEEDSDKEDQDLDKMFGAWLGELDKLTQSLDSDKPTEPVKRSPLRQET
NMANFSYRFSIYNLNEALNQGETVDLDALMADLCSIEQELSSIGAGNSKRQITETKATQK
LPASRHTSKHGTLKGLSSSSNRITKPSHANYSLDDITAQLEQASLSMDEAAQQSVLEDTK
PLVTNQHRRTASAGTVSDAEVRSISNSSRSSITSATSSMDSLDIDKVTRPQELDLTHQGQ
PITEEEQAAKLKAEKIRVALEKIKEAQVKKLVIRVHMSDDSSKTMMVDERQTVRQVLDNL
MDKSHCGYSLDWSLVETISELQMERIFEDHENLVENLLNWTRDSQNKLIFMERIEKYALF
KNPQNYLLGKKETAEMADRNKEVLLEECFCGSSVTVPEIEGVLWLKDDGKKSWKKRYFLL
RASGIYYVPKGKAKLSRELVCFLQLDHVNVYYGQDYRNKYKAPTDYCLVQNHPQIQKKSQ
YIKYLCCDDVRTLHQWVNGIRIAKYGKQLYMNYQEALKRTESAYDWTSLSSSSIKSGSSS
SSIPESQSNHSNQSDSGVSDTQPAGHIRSQSIVSSIFSEAWKRGTQLEESSKARMESMNR
PYTSLVPPLSPQPKLVTPHTASQPSPPLPPPHPPPPPPPPPPPP
Download sequence
Identical sequences E2RBJ6
ENSCAFP00000018937

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]