SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000018965 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000018965
Domain Number 1 Region: 117-253,361-411
Classification Level Classification E-value
Superfamily WD40 repeat-like 2.64e-18
Family WD40-repeat 0.02
Further Details:      
 
Domain Number 2 Region: 5-73
Classification Level Classification E-value
Superfamily F-box domain 3.14e-17
Family F-box domain 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000018965   Gene: ENSCAFG00000012875   Transcript: ENSCAFT00000020438
Sequence length 469
Comment pep:known_by_projection chromosome:CanFam3.1:20:40695951:40710720:-1 gene:ENSCAFG00000012875 transcript:ENSCAFT00000020438 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEFQVPDVPLLKIFSFLDAFSLLQASQVNRCWNRVAENDHLWRNLCLKKWSFCNFSQCLG
SLTWKQFFLKQRKQEYRMALAKPEDFTFREEMPKQKGILGPMAYLSGNDHTVGGQEKSVI
CTVSSKHVLCTWDVQEGTMIWSSPVQQSSIMHLATLPQMHLAFTVDLEGTVKVWNCQDED
ALATLAMPRVCFSLEICLTNDGPFLMVGNSEGDIYTLTVPELRGVSKVNAFKYSVDLLHC
SPDRKWIFASGTHQNILPMVFLTECLLKPSEGNSPLCLSIPFSSCCRACWAPRKTSRVTV
MYRRGSFKKTGFTTFDLMAKRTGGRTDIQGRVATFLLPVHMESPIWMGVGDGNMIVFESG
PYLFLFTISGHLLQRFEDHQRTISNLWVDSVHILTTSMDDSLHLYMWEDEGRYPYLKSCC
HLEHIGSDLAPSCYVSKAICDNMSIVCVVSRIRESSILVMYSLHMNMCS
Download sequence
Identical sequences E2RBE2
ENSCAFP00000018965 ENSCAFP00000018965

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]