SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000019182 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000019182
Domain Number 1 Region: 76-280
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.8e-54
Family SPRY domain 0.0000187
Further Details:      
 
Domain Number 2 Region: 29-84
Classification Level Classification E-value
Superfamily F-box domain 0.00000000000545
Family F-box domain 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000019182   Gene: ENSCAFG00000013028   Transcript: ENSCAFT00000020667
Sequence length 283
Comment pep:known_by_projection chromosome:CanFam3.1:33:29627762:29639189:1 gene:ENSCAFG00000013028 transcript:ENSCAFT00000020667 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRAPAPGPGAASGGAVGGAGAGAGAGAGGGGPGGRLPSRVLELVFSYLELSELRSCALVC
KHWYRCLHGDENSEVWRSLCARSLAEEALRTDILCNLPSYKAKVRAFQHAFSTNDCSRNV
YIKKNGFTLHRNPIAQSTDGARTKIGFSEGRHAWEVWWEGPLGTVAVIGIATKRAPMQCQ
GYVALLGSDDQSWGWNLVDNNLLHNGEVNGIVSTCTHAPKYQIGERIRVILDMEDKTLAF
ERGYEFLGVAFRGLPKVCLYPAVSAVYGNTEVTLVYLGKPLDG
Download sequence
Identical sequences F1PC53
XP_851899.2.84170 ENSCAFP00000019182 ENSCAFP00000019182

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]