SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000019286 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000019286
Domain Number 1 Region: 2-102
Classification Level Classification E-value
Superfamily SH2 domain 2.29e-26
Family SH2 domain 0.00000868
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000019286   Gene: ENSCAFG00000013093   Transcript: ENSCAFT00000020773
Sequence length 134
Comment pep:known_by_projection chromosome:CanFam3.1:38:20304146:20323104:1 gene:ENSCAFG00000013093 transcript:ENSCAFT00000020773 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TDLPYYHGPLSKKDCETLLLKDGIDGNFLLRDSESLPGVLCLCVSFKNLVYTYRIFEERR
GFYNIQTVEGAPKEIFPNLKELISKFEKPSQGLVMHLIQPIKKASSCPRWRRSQIKLDSI
YENNSNSDYVEVLP
Download sequence
Identical sequences F1P9P0
ENSCAFP00000019286 9615.ENSCAFP00000019286 ENSCAFP00000019286

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]