SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000019484 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000019484
Domain Number 1 Region: 2-66
Classification Level Classification E-value
Superfamily Conserved domain common to transcription factors TFIIS, elongin A, CRSP70 3.27e-18
Family Conserved domain common to transcription factors TFIIS, elongin A, CRSP70 0.0018
Further Details:      
 
Weak hits

Sequence:  ENSCAFP00000019484
Domain Number - Region: 547-603
Classification Level Classification E-value
Superfamily F-box domain 0.0268
Family F-box domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000019484   Gene: ENSCAFG00000013220   Transcript: ENSCAFT00000020984
Sequence length 744
Comment pep:known_by_projection chromosome:CanFam3.1:2:75733051:75741998:-1 gene:ENSCAFG00000013220 transcript:ENSCAFT00000020984 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QLLKYLKKLSTLPITVDILAETGVGKTVNSLRKHEHVGSFARDLVAQWKKLVPVERNPEP
DEQDFEKTNSRKRPRDAVQKEEEIEGDYQENWKASSSQSYSPDHRQKKHRKLSEPERTHK
VSHVQERRDERKRCHRISPVYSSDHESSDYGHVQSPPSSASPHQVSMDHYRSLEEDHEPS
VPHQKPGKGHGNAVQDRLAGSQDRHLGDPQGKGASSQHKEHRSSYKEKRPVDARGDGKSS
LSREKSHKAISKEENRRPLSGDSTKEKLPSSGVRREREKEGSSKKSLPSSDVAPDNHLRS
KPKHKDPEKAKSDKNKQSLDSADIGKGTRDRVSNNLKTSEGKVKPSHSDRKSVGSLPKVD
EADMDDEEQPAMSSESDISYDQPRKKKKKMVKTSATTLGEKGLKKNDPKSTNKNSDSVQK
LPKVNENKAEKLQPAGSDLAKLKKVPADALPVLPDLPLPMIQANYRPLPTLELMSSFPPK
RKALSSPQEEEEAGFTGRRMNSKMQVYSGSKCAYLPKMMTLHQQCIRVLKNNIDSIFEVG
GVPFSVLEPVLERCTPDQLYRIEEYNHVLIEETDQLWKVHCHRDFKEERPEEYESWREMY
LRLQDAREQRLRVLTKNIRSAHANKPKGRQAKMAFVNSVAKPPRDVRRRQEKFGTGGAAV
PEKIRIKPAPYPTGNSHAPSGSGSSNSFSASPEQPAYDGPSTSGAHLAPVLSTVSYDPRK
PTVKKIAPMMAKTIKAFKNRFSRR
Download sequence
Identical sequences F1PHL5
ENSCAFP00000019484 ENSCAFP00000019484 9615.ENSCAFP00000019484

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]