SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000019525 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000019525
Domain Number 1 Region: 517-647
Classification Level Classification E-value
Superfamily PH domain-like 3.29e-38
Family Pleckstrin-homology domain (PH domain) 0.0031
Further Details:      
 
Domain Number 2 Region: 180-279
Classification Level Classification E-value
Superfamily PDZ domain-like 6.05e-17
Family PDZ domain 0.015
Further Details:      
 
Domain Number 3 Region: 6-58
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.00000000000419
Family SAM (sterile alpha motif) domain 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000019525   Gene: ENSCAFG00000013228   Transcript: ENSCAFT00000021025
Sequence length 1013
Comment pep:known_by_projection chromosome:CanFam3.1:X:17239021:17462483:1 gene:ENSCAFG00000013228 transcript:ENSCAFT00000021025 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GLDDCLQQYIKNFEREKISGDQLLRITHQELEDLGVSRIGHQELILEAVDLLCALNFLLR
LKNLKTLSHKLNASAKNLQNFITGRRRSGHYDGRTSRKLPNDFLTSVVDLIGAAKSLLAW
LDRSPFAAVTDYSVTRNNVIQLCLELTTIVQQDCTVYETENKILHVCKTLSGVCDHIISL
SSDPLVSQSAHLEVIQLANIKPSEGLGMYIKSTYDGLHVITGTTENSPADRCKKIHAGDE
VIQVNHQTVVGWQLKNLVNALREDPSGVILTLKKRPQSMLTSAPALLKNMRWKPLALQPL
IPRSPTSSVATPSSTISTPTKRDSSALQDLYIPPPPAEPYIPRDEKGNLPCEDLRGHMVG
KPVHKGSESPNSFLDQEYRKRFNIVEEDTVLYCYEYEKGRSSSQGRRESTPTYGKLRPIS
MPVEYNWVGDYEDPNKMKRDSRRENSLLRYMSNEKIAQEEYMFQRNSKKDTGKKSKKKSD
KSNSPTHYSLLPSLQMDALRQDIMGTPVPETTLYHTFQQSSLQHKSKKKNKGPIAGKSKR
RISCKDLGRGDCEGWLWKKKDAKSYFSQKWKKYWFVLKDASLYWYINEEDEKAEGFISLP
EFKIDRASECRKKYAFKACHPKIKSFYFAAEHLDDMNRWLNRINMLTAGYAERERIKQEQ
DYWSESDKEEADTPSTPKQDSPPPPYDTYPRPPSMSCASPYVEAKHSRLSSTETSQSQSS
HEEFRQEVTGSSAVSPIRKTASQRRSWQDLIETPLTSSGLHYLQTLPLEDSVFSDSAAIS
PEHRRQSTLPTQKCHLQDHYGPYPLAESERMQVLNGNGGKPRSFTLPRDSGFNHCCLNAP
VSACDPQDDVQPTEVEEEEEEEEEEGEAAGENIGDKSESREEKLGDSLQDLYRALEQASL
SPLGEHRISTKMEYKLSFIKRCNDPVMNDKLHRLRILKSTLKAREGEVAIIDKVLDNPDL
TSKEFQQWKQMYLDLFLDICQNTTSNDPLSLSSEVDAITSSLTHTHSYIETHV
Download sequence
Identical sequences E2RJX2
ENSCAFP00000019525

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]