SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000019531 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000019531
Domain Number 1 Region: 1-96,160-276
Classification Level Classification E-value
Superfamily Nucleotidylyl transferase 1.59e-29
Family Adenylyltransferase 0.0000365
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000019531   Gene: ENSCAFG00000013252   Transcript: ENSCAFT00000021031
Sequence length 281
Comment pep:known_by_projection chromosome:CanFam3.1:7:16632206:16662846:-1 gene:ENSCAFG00000013252 transcript:ENSCAFT00000021031 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LERARDYLHKTGRFIVIGGIVSPVHDSYGKQGLVSSRHRLIMCQLAVQNSDWIRVDPWEC
YQDTWQTTCSVLEHHRDLMKRVTGCILSNVNTPSMTPVIGQPQNETPQPIYQNSNVSTKP
TAAKILGKVGESLSRICCVRPPVERFTFVDENANLGTVMRYEEIELRILLLCGSDLLESF
CIPGLWNEADMEVIVGDFGIVVVPRDAADTDRIMNHSSILRKYKEGREVVNQEMHVPETT
MQRNTKEWLALQHGDGHVVDYLSQPVIDYILKSQLYINASG
Download sequence
Identical sequences F1PG44
9615.ENSCAFP00000019531 ENSCAFP00000019531

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]