SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000019558 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000019558
Domain Number 1 Region: 32-265,300-325
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 4.06e-55
Family BAR domain 0.017
Further Details:      
 
Domain Number 2 Region: 281-368
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000833
Family Pleckstrin-homology domain (PH domain) 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000019558   Gene: ENSCAFG00000013278   Transcript: ENSCAFT00000021061
Sequence length 369
Comment pep:known_by_projection chromosome:CanFam3.1:2:75944780:75985917:1 gene:ENSCAFG00000013278 transcript:ENSCAFT00000021061 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPEQLSVAEFLAVTAEDLSSPAGAAAFAAKMPRCRGAALAREEILEGDQAILQRIKKAVR
AIHSSGLGHVENEEQYREAVESLGNSHLSQNSHELSTGFLNLAVFTREVAALFKNLVQNL
NNIVSFPLDSLLKGQLRDGRQDSKKQLEKAWKDYEAKMAKLEKERDRARVTGGSLGEVAQ
DTQRERRVFQLHMCEYLLRAGESQMKQGPDFLQSLIKFFHAQHNFFQDGWKAAQSLSPFI
EKLAASVHALRQAQEEELQKLTQLRDSLRGTLQLESREENLSRKNSGGGYSIHQHQGNKQ
FGTEKVGFLYKKSDGIRRVWQKRKCGVKYGCLTISHSTINRPPVKLTLLTCQVRPNPEEK
KCFDLVTRE
Download sequence
Identical sequences E2RJ10
ENSCAFP00000019558 ENSCAFP00000019558

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]