SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000019654 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000019654
Domain Number 1 Region: 735-924
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 7.4e-61
Family Nucleotide and nucleoside kinases 0.000000055
Further Details:      
 
Domain Number 2 Region: 556-670,729-763
Classification Level Classification E-value
Superfamily SH3-domain 1.58e-31
Family SH3-domain 0.0000555
Further Details:      
 
Domain Number 3 Region: 454-553
Classification Level Classification E-value
Superfamily PDZ domain-like 6.97e-31
Family PDZ domain 0.000025
Further Details:      
 
Domain Number 4 Region: 208-312
Classification Level Classification E-value
Superfamily PDZ domain-like 5.78e-29
Family PDZ domain 0.000025
Further Details:      
 
Domain Number 5 Region: 314-407
Classification Level Classification E-value
Superfamily PDZ domain-like 2.89e-26
Family PDZ domain 0.000044
Further Details:      
 
Domain Number 6 Region: 4-63
Classification Level Classification E-value
Superfamily L27 domain 1.41e-21
Family L27 domain 0.0000385
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000019654   Gene: ENSCAFG00000013275   Transcript: ENSCAFT00000021165
Sequence length 927
Comment pep:known_by_projection chromosome:CanFam3.1:33:30015084:30252578:-1 gene:ENSCAFG00000013275 transcript:ENSCAFT00000021165 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPVRKQDTQRALHLLEEYRSKLSQTEDRQLRSSIERVINIFQSNLFQALIDIQEFYEVTL
LDNPKCIDRSKQSEPIQPVNTWEISSLPSTTVTSETLPSSLSPSVEKYRYQDEDTPPQEH
ISPQITNEVIGPELVHVSEKNLSEIENVHGFVSHSHISPIKPTEAVPPSSPTVPVIPVLP
VPAENTVILPTIPQANPPPVLVNTDSLETSTYVNGTDADYEYEEITLERGNSGLGFSIAG
GTDNPHIGDDSSIFITKIIAGGAAAQDGRLRVNDCILRVNEVDVRDVTHSKAVEALKEAG
SIVRLYVKRRKPVSEKIMEIKLIKGPKGLGFSIAGGVGNQHIPGDNSIYVTKIIEGGAAH
KDGKLQIGDKLLAVNSVCLEEVTHEEAVTALKNTSDFVYLKVAKPTSMYMNDGYAPPDIT
NSSSQPVDNHVSPSSYLGHTPASPARYSPVSKAMLGDDEITREPRKVVLHRGSTGLGFNI
VGGEDGEGIFISFILAGGPADLSGELRKGDRIISVNSVDLRTASHEQAAAALKNAGQAVT
IVAQYRPEEYSRFEAKIHDLREQMMNSSISSGSGSLRTSQKRSLYVRALFDYDKTKDSGL
PSQGLNFKFGDILHVINASDDEWWQARQVTPDGESDEVGVIPSKRRVEKKERARLKTVKF
NSKTRGDKGQSFNDKRKKNLFSRKFPFYKNKDQSEQETSDADQHITSNASDSESSYRGQE
EYVLSYEPVNQQEVNYTRPVIILGPMKDRINDDLISEFPDKFGSCVPHTTRPKRDYEVDG
RDYHFVTSREQMEKDIQEHKFIEAGQYNNHLYGTSVQSVREVAEKGKHCILDVSGNAIKR
LQIAQLYPISIFIKPKSMENIMEMNKRLTEEQARKTFERAMKLEQEFTEHFTAIVQGDTL
EDIYNQVKQIIEEQSGPYIWVPAKEKL
Download sequence
Identical sequences F1PCU2
XP_545159.2.84170 ENSCAFP00000019654

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]