SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000019767 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000019767
Domain Number 1 Region: 113-377
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.59e-76
Family Protein kinases, catalytic subunit 0.0000154
Further Details:      
 
Domain Number 2 Region: 37-110
Classification Level Classification E-value
Superfamily SH3-domain 1.23e-20
Family SH3-domain 0.00079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000019767   Gene: ENSCAFG00000013415   Transcript: ENSCAFT00000021287
Sequence length 630
Comment pep:known_by_projection chromosome:CanFam3.1:18:51594274:51607361:1 gene:ENSCAFG00000013415 transcript:ENSCAFT00000021287 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPLKNLFLKSPLGSWNSSGGGGSGGSGGGWPEGSPKTAAYANPVWTALFDYEPNGQDEL
ALRKGDRVEVLSRDAAISGDEGWWAGQVGGQVGIFPSNYVSRGGGPPPCEVASFQELRLE
EVIGIGGFGKVYRGSWRGELVAVKAARQDPDEDISVTAESVRQEARLFAMLAHPNIIALK
AVCLEEPNLCLVMEYAAGGPLSRALAGRRVPPHVLVNWAVQIARGMHYLHCEALVPVIHR
DLKSNNILLLQPIEGDDMDHKTLKITDFGLAREWHKTTQMSAAGTYAWMAPEVIKASTFS
KGSDVWSFGVLLWELLTGEVPYRGIDCLAVAYGVAVNKLTLPIPSTCPEPFAQLMADCWA
QDPHRRPDFASILQQLEALEAQVLREMPRDSFHSMQEGWKREIQGLFDELRAKEKELLSR
EEELTRAAREQRSQAEQLRRREHLLAQWELEVFERELTLLLQQVDRERPHVRRRRGTFKR
SKLRARDGGERISMPLDFKHRITVQASPGLDRRRNVFEVGAGDSPTFPRFRAIQLEPAEP
GQAWGRQSPRRLEDSSNGERRACWAWGPSSPKPGEAQNGRRRSRLDEAAWYLDSDDSSSL
GSPSTPPMLNGNPPRPRGSPEPEEPRRPGL
Download sequence
Identical sequences F1PAC5
ENSCAFP00000019767 ENSCAFP00000019767 XP_540853.4.84170

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]