SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000019862 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSCAFP00000019862
Domain Number - Region: 66-112,139-176
Classification Level Classification E-value
Superfamily PH domain-like 0.0629
Family Pleckstrin-homology domain (PH domain) 0.047
Further Details:      
 
Domain Number - Region: 323-387,421-521
Classification Level Classification E-value
Superfamily ARM repeat 0.0748
Family MIF4G domain-like 0.08
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000019862   Gene: ENSCAFG00000013490   Transcript: ENSCAFT00000021393
Sequence length 913
Comment pep:known_by_projection chromosome:CanFam3.1:7:18024725:18109645:-1 gene:ENSCAFG00000013490 transcript:ENSCAFT00000021393 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GKTEATIKNFSPFYSRQYAVAFCNHVRSEVEQQRDLTSQFLKTKPPLEPGTVLYEAELSQ
FAEDIKKWKERYIVIKNDFAVESYENKEAYQRGVAPKSRILPAGGKVLTSENEYNLLSDR
FFPDPLAPSEKENAQPFVVLPKEFPVYLWQPFLRHGYFCFHEATDQKKFSALLSDCIRHL
NHDYTKQMTFEAQAFLEAVQFFRQEKGHYGSWEMITGDEVQILSNLVMEELLPTLQTDLL
PKMKGKKNDRKRAWFGLLEDAYNLVQHQVSEGLSTLKEECRTLTKGLEGTIRSDMDQIVN
SKNFLIGKIKAMVAQPAERSCAESVQPFLASILEELMGPVSSGFSEVRSLFEKEVDELSQ
KFQTTKDSAQLKECSRQLMNLPLDSLKMEPCYSKVNLLQERLQDLKSRFRFPHVDLVVQR
TQNYMQELMENAVFTFEQLLSPHLQGETSKTAVAIEKVKLRVLKQYDYDSSTIRKRIFQE
ALVQITLPTVQKALASTCKPELQKYEQFIFADHTNMIHVENVYEEILHQSLLDETLKVIK
EAAILKKHNLFEDNMALPSESVSSLTDIKTSAGSNQASPARRASALLPGVSDSETLSNEV
FQESGEKKQPGVSSPLAKEESLSFPVPTPPPVGTGQMIISGMDGPLVDLVTAEDTAGALG
THSSELEFGGAPKDGEPTHEKPESSSASSSLKELRNLLTVTIEVPVESSTLEIEEDTNEE
TLAPQEMEKLEETTPTYTEANQAAASSQDSCEESEISGREAHPPPLEAEASREELGGFLG
AELAREGLNPGASSPDPTEQQAEAGEPTEGEIQGRSSSLDAQDERGAASIVEDEARPQED
CTSGAHHTCPSESPVSVEETLGGTSSMTQATTSVKTEEIKAAGVHECQWVVENAPNIDLL
GSPDLGESTPEQP
Download sequence
Identical sequences F1P703
ENSCAFP00000019862

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]