SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000019864 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000019864
Domain Number 1 Region: 65-196
Classification Level Classification E-value
Superfamily Nucleotidylyl transferase 1.09e-26
Family Cytidylyltransferase 0.0058
Further Details:      
 
Weak hits

Sequence:  ENSCAFP00000019864
Domain Number - Region: 194-264
Classification Level Classification E-value
Superfamily Outer surface protein C (OspC) 0.00157
Family Outer surface protein C (OspC) 0.0089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000019864   Gene: ENSCAFG00000013493   Transcript: ENSCAFT00000021395
Sequence length 357
Comment pep:known_by_projection chromosome:CanFam3.1:X:20079962:20153452:-1 gene:ENSCAFG00000013493 transcript:ENSCAFT00000021395 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EVGHSPCSNVWIILQSSSQGPPVLRETLTAPAPFADETSCQCQAPHEKLTIAQARLGTPV
DRPVRVYADGIFDLFHSGHARALMQAKTLFPNSYLLVGVCSDDLTHKFKGFTVMNEAERY
EALRHCRYVDEVIRDAPWTLTPEFLEKHKIDFVAHDDIPYSSAGSDDVYKHIKEAGMFVP
TQRTEGISTSDIITRIVRDYDVYARRNLQRGYTAKELNVSFINEKKYRFQNQVDKMKEKV
KNVEERSKEFVNRVEEKSHDLIQKWEEKSREFIGNFLELFGPDGAWWKQMFQERSSRMLQ
ALSPKQSPVSSPTRSRSPSRSPSPTFSWLPNKASPPSSPKAASASISSMSEGDEDEK
Download sequence
Identical sequences E2RFX3
ENSCAFP00000019864 ENSCAFP00000034086

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]