SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000019894 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000019894
Domain Number 1 Region: 457-524
Classification Level Classification E-value
Superfamily A DNA-binding domain in eukaryotic transcription factors 7.32e-24
Family A DNA-binding domain in eukaryotic transcription factors 0.001
Further Details:      
 
Domain Number 2 Region: 509-561
Classification Level Classification E-value
Superfamily Leucine zipper domain 0.00000239
Family Leucine zipper domain 0.0036
Further Details:      
 
Weak hits

Sequence:  ENSCAFP00000019894
Domain Number - Region: 263-377
Classification Level Classification E-value
Superfamily Serpins 0.0356
Family Serpins 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000019894   Gene: ENSCAFG00000013506   Transcript: ENSCAFT00000021426
Sequence length 608
Comment pep:known_by_projection chromosome:CanFam3.1:36:20989706:20993982:-1 gene:ENSCAFG00000013506 transcript:ENSCAFT00000021426 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SHSDRHLPTTGHQQWHNDMDLIDILWRQDIDLGVSREVFDFSQRRKEHELEKQKKLEKER
QEQLQKEQEKAFFAQLQLDEETGEFLPVQPAPHIPSETSASANYSQVPHIPKPDALYFDD
CMQLLAETFPFVDDNEVSSAAFQSLVPDIPSQIENPVFIAPNQAQSPQTLAVQSVIADLD
NMQQDIEQVWEELLSIPELQCLNIQNDKLVETSMVPSPETKMTEIDNNYHFYPSMPSLEK
EVGNCSPPFLSAFEDSFSSILSTEDSSQLTVNSLNSDATINTDFGDEFYSAFIAEPSSSN
SMPSSASFSQSLSELLNGPIDVSDLSLCKAFNQNHPESTEFNDSDSGISLNTSPGMASPE
HSVESSVYGDTALGFSDSEMEETDSAPGSVKQTGPKTQPGQSAGDPAQPPSPSPGPSAPA
HDAQCENTPKKESPVNPGHRKAPFTKDKHSSRLEAHLTRDELRAKALHIPFPVEKIINLP
VDDFNEMMSKEQFNEAQLALIRDIRRRGKNKVAAQNCRKRKLENIVELEQDLDHLKDEKE
KLLKEKGENDKSLHLLKKQLSTLYLEVFSMLRDEDGKPYSPSEYSLQQTRDGNVFLVPKS
KKPDIKKN
Download sequence
Identical sequences F1P6Y9
ENSCAFP00000019894 ENSCAFP00000033899

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]