SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000019941 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000019941
Domain Number 1 Region: 193-287
Classification Level Classification E-value
Superfamily Cyclin-like 0.00000000000248
Family Cyclin 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000019941   Gene: ENSCAFG00000013539   Transcript: ENSCAFT00000021473
Sequence length 363
Comment pep:known_by_projection chromosome:CanFam3.1:37:16075515:16110785:1 gene:ENSCAFG00000013539 transcript:ENSCAFT00000021473 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGNTLTCCVSSNASPKLGRGTGPADPDYESDVYQAAAGDAVAVAPAPATVEPAELDFGAG
EGHHLQHISDREMPEDLALESNPSDHPRASTIFLSKSQTDVREKRKSNHLNHVSPGQLTK
KYSSCSTIFLDDSTVSQPNLRTTIKCVTLAIYYHIKNRDANRSLDIFDERSHPLTREKVP
EEYFKHDPEHKFIYRFVRTLFSAAQLTAECAIVTLVYLERLLTYAEIDICPTNWKRIVLG
AILLASKVWDDQAVWNVDYCQILKDITVEDMNEMERHFLELLQFNINVPSSVYAKYYFDL
RSLADDNNVNFLFAPLSKERAQNLEAISRLCEDKYKDWSRAAMRRSFSADNFIGIQRSNA
ILS
Download sequence
Identical sequences E2QVS1
ENSCAFP00000019941 9615.ENSCAFP00000019941 ENSCAFP00000019941 XP_005640648.1.84170

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]