SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000019972 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000019972
Domain Number 1 Region: 352-479
Classification Level Classification E-value
Superfamily PH domain-like 4.56e-24
Family Pleckstrin-homology domain (PH domain) 0.0034
Further Details:      
 
Domain Number 2 Region: 203-313
Classification Level Classification E-value
Superfamily PH domain-like 4.2e-17
Family Pleckstrin-homology domain (PH domain) 0.014
Further Details:      
 
Weak hits

Sequence:  ENSCAFP00000019972
Domain Number - Region: 505-523,670-721
Classification Level Classification E-value
Superfamily Multiheme cytochromes 0.00614
Family Di-heme elbow motif 0.065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000019972   Gene: ENSCAFG00000013559   Transcript: ENSCAFT00000021506
Sequence length 757
Comment pep:known_by_projection chromosome:CanFam3.1:37:16183395:16418277:-1 gene:ENSCAFG00000013559 transcript:ENSCAFT00000021506 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEALEVDDISPALEVTEDFFSTFDSKLEKAVQQAEVYGIQEVPELVGHEVLTNITDNGAI
RNVASLGKGGLIWDHCKSRLLETKAQNVFPAKEQFMVQKGTAPDNLSWMEQKEASTFNFF
NICQRRRDRPRSVNDLLDETSTFKPGHTRSRSDITQVDWRLVLQTMPLQQQPCLRGPHFT
RPAFLSSSPNKVEDAQGNTEHKQAFPNILKKGYLEIRKDHDSYWQSCYAELSPYNLYFYS
LDSSGNQALYATYQLSHFQSISVLGNLEARLVDTVLYDNTQLQLKAESPWEALDWGQKLW
EVVHAAVPGYVGRQDELANSPGLGHHVDCTQNHCLQKKSSELFAPSPVLDSPKQYQNIIK
SGTLYRLTVQNNWKAFTFVLSRAYLMAFQPGKLDEDPLLSYNVDVCLAVQMDNLDDCDSC
FQVIFPQDVLRLRAETRQRAEEWMEALRTAANAARSSEQNLQVTLRSKPKDQMGGHELRK
NKRQSVTTSFLSILTTLSLERGLTAQSFKCAGCQRSIGLSNGKAKVCNYSGWYYCSNCHV
DDSFLIPARIVHNWDTSKYKVSKQAKEFLEYVYEEPLIDIQRENPMLYLHAEPLATVVRL
RQRLKSLRAYLFSCRAAVAEDLRRRIFPREYLLQQIHLYSLADLQQVIEGKLAPFLGKVI
KFATSHVYSCSLCSQKGFICEICNNGEILYPFEDISTSRCESCGAVFHAECKEKSVPCPR
CVRRELQKKQKSFWRRLNVDESLEEACNMFELSYQNT
Download sequence
Identical sequences E2QUW8
ENSCAFP00000019972 ENSCAFP00000019972 9615.ENSCAFP00000019972 XP_013966485.1.84170 XP_536046.3.84170

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]