SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000020055 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000020055
Domain Number 1 Region: 18-108
Classification Level Classification E-value
Superfamily WWE domain 9.03e-24
Family WWE domain 0.0013
Further Details:      
 
Domain Number 2 Region: 107-183
Classification Level Classification E-value
Superfamily WWE domain 1.57e-22
Family WWE domain 0.00088
Further Details:      
 
Domain Number 3 Region: 344-444
Classification Level Classification E-value
Superfamily RING/U-box 6.71e-19
Family RING finger domain, C3HC4 0.00000423
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000020055   Gene: ENSCAFG00000013614   Transcript: ENSCAFT00000021597
Sequence length 574
Comment pep:known_by_projection chromosome:CanFam3.1:6:7605383:7645027:1 gene:ENSCAFG00000013614 transcript:ENSCAFT00000021597 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAMAPSPSLAQVYTSPVAVAVWEWQDGLGTWHPYSATVCSYIEQQFVQQKGQRFGLGSLA
HSIPLGQADPSLAPYIIDLPSWTQFRQDTGTMRAVRRHLFPQQSAPGRGIVWEWLSDDGS
WTAYEASVCDFLEQQMARGNQLVDLAPLGYNYTVNYATHTQTNKTSSFCRSVRRQAGTPY
PVTTIIAPPGHTGVACSCHQCLSGGGTGPVSGRYRHSMTNLPAYPVPQPPHRTAIVFGAH
QAFAPYSKPSLSGARSAPRLNTANPWGGAPPSLGSQPLYRSSLSHLGLQHQPPGLSTASG
ASASLPSGPVSSPGSIPAAVPMQMQMPKPSRVQQALAGGTPKPEPEQVIKKYTEELKMAS
DEDCIICMEKLSVVSGYSDVTHSKTIGPVAVGRLAKCSHAFHLLCLLAMYCNGNKDGSLQ
CPSCKTIYGEKTGTQPRGKMEVFKFQVSLPGHEDCGTILIVYNIPHGIQGPEHPNPGKPF
TARGFPRQCYLPDNAQGRKVLELLKVAWKRRLIFTVGTSSTTGETDTVVWNEIHHKTEMD
RNVTGHGYPDPNYLQNVLAELAAQGVTEDCLEQP
Download sequence
Identical sequences E2R8C4
ENSCAFP00000020055 ENSCAFP00000020058 XP_013969654.1.84170

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]