SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000020117 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000020117
Domain Number 1 Region: 218-470
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 1.74e-65
Family Nuclear receptor ligand-binding domain 0.00065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000020117   Gene: ENSCAFG00000013658   Transcript: ENSCAFT00000021662
Sequence length 471
Comment pep:known_by_projection chromosome:CanFam3.1:X:25396523:25401715:-1 gene:ENSCAFG00000013658 transcript:ENSCAFT00000021662 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGEDHQWQGSILYNMLMSAKQTHAAPVAPEARLGGACWGCSCGAEPAPGRGALPGARTT
ALLYRCCFCGEEHPRQGSILYNMLTSAKQTRAAAEAPEARLGGACWGCSCGAEPAAGRGA
LPEARTTVLLYRCCFCGEEHPRQGSILYSLLTSAKQTHVAPETPEVRPGGAWWGRSYSAQ
GPGGREQLPGRQAVAYLSRCCFCGDEHPRPGSIFHRLPASAKQTHAAREMQPAAPWWDPR
CDAQRRVALKSPQVVCEAASAGLLKTLRFVKYLPCFQVLPLDQQLVLVRNSWAPLLLLEL
AQDRLNFETVETSEPSLLQRILTTRRRETAGDEPPPPTPQPPPLVPPREAGRLPTAAEVQ
AIKCFLAKCWSLDISTKEYAYLKGTVLFNPDLPGLHCVKYIQGLQWGAQQILSDHIRMTH
RGYQARFTELNSALFLLRYVNADVIVELFFRPIIGSVSMDDMMLEMLCAKL
Download sequence
Identical sequences E2R3L9
ENSCAFP00000020117 ENSCAFP00000020117 XP_003640302.1.84170

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]