SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000020142 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000020142
Domain Number 1 Region: 316-659
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 2.35e-72
Family p120GAP domain-like 0.0001
Further Details:      
 
Domain Number 2 Region: 164-292
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 2.53e-31
Family Synaptotagmin-like (S variant) 0.0014
Further Details:      
 
Domain Number 3 Region: 617-758
Classification Level Classification E-value
Superfamily PH domain-like 2e-29
Family Pleckstrin-homology domain (PH domain) 0.0053
Further Details:      
 
Domain Number 4 Region: 59-180
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.2e-26
Family PLC-like (P variant) 0.061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000020142   Gene: ENSCAFG00000013668   Transcript: ENSCAFT00000021687
Sequence length 854
Comment pep:known chromosome:CanFam3.1:6:7682984:7705477:1 gene:ENSCAFG00000013668 transcript:ENSCAFT00000021687 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKWKRFPRPRAHLPRPARPAPRGAQSRARPPASCARPRRPAPPGPDPRRGPAMAKRSSLS
IRIVEGKNLPAKDITGSSDPYCIVKVDNEPIIRTATVWKTLCPFWGEEYQVHLPPTFHAV
AFYVMDEDALSRDDVIGKVCLTRDTLAAHPKGFSGWAHLTEVDPDEEVQGEIHLRLEVVR
GPGPCRLRCSVLEARDLAPKDRNGASDPFVRVRYNGRTQETSIVKKSCYPRWNETFEFEL
EEGAAEALCVEAWDWDLVSRNDFLGKVVFNVQRLWAAQQEEGWFRLQPDQSKSRRGEGSL
GSLQLEVRLWDETVLPSGCYQPLVQLLCHEVKLGTQGPGQLIPLIEETTSTECRQDVATN
LLKLFLGQGLAKDFLDLLFQLELGRTSEANTLFRSNSLASKSMESFLKVAGMRYLHGVLG
PIIDRVFEEKKYVELDPSRVEVKDVGCSGLHRPQTEAEVLEQSAQTLRVHLGALLSALSR
SVRACPAVVRATFRQLFLRVRERFPGAQHENVPFIAVTSFLCLRFVSPAIMAPKLFHLRE
RHADARTSRTLLLLAKAVQNVGNMDTPASRAKEAWMEPLQPTVRQGVAQLKDFITKLVDI
GEKEELDLQRALSLQAPPVKEGPLFIHRTKGKGPLMSSFKKLHFSLTTEALSFAKTPNSK
KSALIKLANIRAAEKVEEKSFGSSHVMQVIYEDDAGKPQTIYLQCKCVNELNQWLSALRK
MSISNPGLLGSYHPGIFRGDKWSCCHQKDKSDLGCDKTRSRVTLQEWNDPLDHDLEAQLI
YRHLLGVEAMLREKQRELSAAGTEAGSALRGSGEAPKDPLAQLFQVLQDLREAHRSSPAS
VPPSETNRLLELQT
Download sequence
Identical sequences F1PXF8
ENSCAFP00000020142 ENSCAFP00000020142

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]