SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000020218 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000020218
Domain Number 1 Region: 507-625
Classification Level Classification E-value
Superfamily SH2 domain 1.09e-26
Family SH2 domain 0.00067
Further Details:      
 
Domain Number 2 Region: 336-416
Classification Level Classification E-value
Superfamily Nucleotidylyl transferase 0.00000219
Family ATP sulfurylase catalytic domain 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000020218   Gene: ENSCAFG00000013723   Transcript: ENSCAFT00000021767
Sequence length 631
Comment pep:known_by_projection chromosome:CanFam3.1:30:11590211:11609837:-1 gene:ENSCAFG00000013723 transcript:ENSCAFT00000021767 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LFFLGYFPVRRPWGKGGVQALGTQTCEVPRVSCELGRGTDGDRCAPTGARVGTRGGLTFG
PGFASPALGVAHFLPVCPHPLEARTPPPPRQGEADPDRERNPAPPLLPTSPAPPPPGGAP
PPHPPPAGRRAPRAPLAQSGWPHVTERSSPGGLRPGAAGAGEPGERPGGVAPGPGGAGAG
PGGGGSGGVSKWLREHLGFRGGGGGGGGGKPAPPEPDYRPPAPSPAAPPAPPPDILAAYR
LQRERDFEDPYSGGPSSSAAAPATPTAPGPTPPPRHGSPPHRLIRVETPGPPAPPPEERI
SGPPAGSDRLAILEDYADPFDVQETGEGPAGASGAPEKVPENDGYMEPYEAQKMMAEIRS
SKETAAQPLPLYDTPYEPEEEGTTPEGEGTPWPRESRLPEDDERPPEEYDQPWEWKKERI
SKAFAVDIKVIKDLPWPPPVGQLDSSPSLPDGDRDISGPASPLPEPSLEDSSAQFEGSEK
SCLSPGREEKGRLPPRLSAGNPKSAKPLGMEPSSPLGEWTDPALPLENQVWYHGAISRTD
AENLLRLCKEASYLVRNSETSKNDFSLSLKSSQGFMHMKLSRTKEHKYVLGQNSPPFSSV
PEIVHHYASRKLPIKGAEHMSLLYPVAIRTL
Download sequence
Identical sequences F1Q3E6
ENSCAFP00000020218 ENSCAFP00000020218

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]