SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000020298 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000020298
Domain Number 1 Region: 345-444
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 2.35e-23
Family BCR-homology GTPase activation domain (BH-domain) 0.00032
Further Details:      
 
Domain Number 2 Region: 95-219
Classification Level Classification E-value
Superfamily PH domain-like 6.72e-19
Family Pleckstrin-homology domain (PH domain) 0.0084
Further Details:      
 
Domain Number 3 Region: 34-62
Classification Level Classification E-value
Superfamily WW domain 0.0000839
Family WW domain 0.0046
Further Details:      
 
Weak hits

Sequence:  ENSCAFP00000020298
Domain Number - Region: 6-34
Classification Level Classification E-value
Superfamily WW domain 0.00102
Family WW domain 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000020298   Gene: ENSCAFG00000013770   Transcript: ENSCAFT00000021851
Sequence length 446
Comment pep:known_by_projection chromosome:CanFam3.1:9:18188914:18198724:1 gene:ENSCAFG00000013770 transcript:ENSCAFT00000021851 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XEPRPTSPLAAPPGWSCHVSPEGQTLYTNHYTQEQWVRLEDQHGKPYFYNPEDTSVQWEL
PQVPVPAPRSICRSNQDSETPAQASPPEEKIKTLDKAGVLHRTKTVDKGKRLRKKHWSAS
WTVLEGGVLTFFKDSKASAAGGLRQPPKLSTPEYTVELRGASLSWAPKEKSSRKNVLELQ
SRDGSEYLIQHDSEAIISTWHKAISEGIQEVSADLPPEEESQSSGADFGSSERLGSWRED
EARLGAVPHCPGPGAAAAEGDLSKVRHRLRKFLLKRPTLQSLREKGYIQDQVFGCPLXHF
RQFIAAISEPLGGGIGGRTGPPSSGHPLGGPLSPPPGCSLSVPLAEPTLPSPELQDQAQR
CRCVRDLVRSLPAPNHDTLRLLFQHLCRVIDHGNQNRMSVQSVAIVFGPTLLRPETEETS
MPMTMVFQNQVVELILQRCSDIFPPH
Download sequence
Identical sequences F1PM00
ENSCAFP00000020298 ENSCAFP00000020298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]