SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000020337 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000020337
Domain Number 1 Region: 855-1022
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 3.34e-51
Family BCR-homology GTPase activation domain (BH-domain) 0.0000508
Further Details:      
 
Domain Number 2 Region: 296-497
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.44e-45
Family DBL homology domain (DH-domain) 0.00054
Further Details:      
 
Domain Number 3 Region: 511-580,638-673
Classification Level Classification E-value
Superfamily PH domain-like 7.4e-17
Family Pleckstrin-homology domain (PH domain) 0.019
Further Details:      
 
Domain Number 4 Region: 715-841
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.0000000000000951
Family Synaptotagmin-like (S variant) 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000020337   Gene: ENSCAFG00000013773   Transcript: ENSCAFT00000021894
Sequence length 1076
Comment pep:known_by_projection chromosome:CanFam3.1:26:27856081:27979095:1 gene:ENSCAFG00000013773 transcript:ENSCAFT00000021894 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQMERKKSQLGAGPGPGPADAPRPSYRGRPSESSCGLDGDYEDAELNPRFLKDNLINANG
GGRPPWPPLEYQPYQSIYVGGMMMEGDAKGPLLRSQSTSEQEKRLTWPRRSYSPRSFEDS
GGGYTPDCSSNENLTSSEEDFSSGQSSRVSPSPTTYRMFRDKSRSPSQNSQQSFDSSSPP
TPQCHKRHRQGQVIVAEATIVGVRKTGQIWPSDGDSLSGRLPQDGTFHGDPDASFGTPPG
YGCAADRAEEQRRHQDGLPYIDDSPSSSPHLGSKGRGSRDTLASGALESTKVSELDLEKG
MEMRKWVLSGILASEETYLSHLEALLLPMKPLKAAATTSQPVLTSQQIETIFFKVPELYE
IHKEFYDGLFPRVQQWSHQQRVGDLFQKLASQLGVYRAFVDNYGVAMETAEKCCQANSQF
AEISENLKARSNKDAKDQTTKNSLETLLYKPVDRVTRSTLVLHDLLKHTPSSHPDHPLLQ
DALRISQNFLSSINEEITPRRQSMTVKKGEHRQLLKDSFMVELVEGARKLRHVFLFTDLL
LCTKLKKQSGGKTQQYDCKWYIPLTDLSFQTVDESEAAPNIPLVLDEELDAMKIKISQIK
NDIQREKRANKGSKAIERLKKKLSEQESLLLLMSPSMAFRVHSRNGKSYTFLISSDYERA
EWRENIREQQKKCFKSFSLTSVELQMLTNSCVKLQTVHSIPLTINKEDDESPGLYGFLNV
IVHSATGFKQSSNLYCTLEVDSFGYFVNKAKTRVYRDTAEPNWNEEFEIELEGSQTLRIL
CYEKCYNKTKITKEDGESTDRIMGKGQVQLDPQALQDRDWQRTVIAMNGIEVKLSVKFTS
REFSLKRMPSRKQTGVFGVKIAVVTKRERSKVPYIVRQCVEEIERRGMEEVGIYRVSGVA
TDIQALKAAFDVNNKDVSVMMSEMDVNAIAGTLKLYFRELPEPLFTDEFYPNFAEGIALS
DPVAKESCMLNLLLSLPEANLLTFLFLLDHLKRVAEKETVNKMSLHNLATVFGPTLLRPS
EKESKLPANPSQPISMTDSWSLEVMSQVQVLLYFLQLEAIPAPDSKRQSILFSTEV
Download sequence
Identical sequences F6V909
ENSCAFP00000020337 ENSCAFP00000020337

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]