SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000020492 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000020492
Domain Number 1 Region: 32-402
Classification Level Classification E-value
Superfamily Serpins 3.14e-115
Family Serpins 0.00000000000647
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000020492   Gene: ENSCAFG00000013909   Transcript: ENSCAFT00000022067
Sequence length 402
Comment pep:known chromosome:CanFam3.1:6:8719546:8727277:-1 gene:ENSCAFG00000013909 transcript:ENSCAFT00000022067 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQMSPVFACLALGLALVFGEASASYSYQTRAAGLATDFGVKVFQEVARASKDRNMVFSPY
GVASVLAMLQLTTAGETCRQIQEAMQFQIDEKGMAPALRQLYKELMGPWNKDEISTADAI
FVQRDLKLVHGFMPHFFRLFRTTVKQVDFSEVERARFIVNDWVKRHTKGMIGNLLGRGAV
DQLTRLMLVNALYFNGQWKTPFPESGTHHRLFHKSDGSTVSVPMMAQTNKFNYTEFSTPS
GHYYDILELPYHGDTLSMFIAAPYEKEVPLSALTNILDAQLISQWKGNMTRQLRLLVLPK
FSLETEVNLRRPLENLGMTDMFRPNLADFSSLSNQEVLYVSRALQKVKIEVNESGTVASS
STAIIVSARMAPEEIIMDRPFLFVVRHNPTGTVLFMGQVMEP
Download sequence
Identical sequences F1PUI4
ENSCAFP00000020492 ENSCAFP00000020492 NP_001184024.1.84170 XP_005620953.1.84170 XP_013969599.1.84170

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]