SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000020510 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000020510
Domain Number 1 Region: 70-137
Classification Level Classification E-value
Superfamily F-box domain 0.00000000000327
Family F-box domain 0.003
Further Details:      
 
Weak hits

Sequence:  ENSCAFP00000020510
Domain Number - Region: 201-357
Classification Level Classification E-value
Superfamily RNI-like 0.00279
Family 28-residue LRR 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000020510   Gene: ENSCAFG00000013926   Transcript: ENSCAFT00000022086
Sequence length 558
Comment pep:known_by_projection chromosome:CanFam3.1:8:17497569:17528249:-1 gene:ENSCAFG00000013926 transcript:ENSCAFT00000022086 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLFLSVPQPRPPGARTRAGAARVARWRRLRLRRQQLRRLRGLLRGLRGRPGAGGRRRGR
MALCGQAAGAASLPSELIVHIFSFLPAPDRLRASASCSHWRECLFYPALWPQLRICLRVS
PAEQPRLEFLMRKCGWFVRELRVEFAAENYLSGGGGPGDGGGADPGTGGEEVEALQLSTR
WLEVLRTYLELVLCVLVSIRNNRNLQKFSLFGDISVLQQQGSLSNTYLNKVDPDGKKIKQ
IQQLFEEILSNSRQLKWLSCGFMLEIVTPTSLSSLSNSIANTMEHLSLLDNNIPGNSTLI
TTVELERFVNLRSLALDFCDFTAEMARVLTDSNHVPLQRLSLLVHNVSVMHKSLDNMPND
EHWKALARKSTGLRVYIMAFDIKSEDMLKILKPSIPLERIHFDSYITCVSGAIVDLISRQ
YDKFLTHFILMNDVIDTSGFPDLSDNRNEDPLVLLAWRCTKLSLLAIHGYTVWAHNLIAI
ARLRGSDLKVLEVTEESIDFDQGELADQDVDPVHNLIEQVSLGLGQPWHAVMDIESLSVF
TEPNRHFYREMQSFSEDI
Download sequence
Identical sequences F1PPJ7
ENSCAFP00000020510 ENSCAFP00000020510 XP_850997.1.84170

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]