SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000020521 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000020521
Domain Number 1 Region: 4-132
Classification Level Classification E-value
Superfamily PH domain-like 2.46e-55
Family Necap1 N-terminal domain-like 0.000000323
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000020521   Gene: ENSCAFG00000013930   Transcript: ENSCAFT00000022099
Sequence length 275
Comment pep:known_by_projection chromosome:CanFam3.1:27:37460607:37470821:1 gene:ENSCAFG00000013930 transcript:ENSCAFT00000022099 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAELEYESVLCVKPDVSVYRIPPRASNRGYRASDWKLDQPDWTGRLRITSKGKIAYIKL
EDKVSGELFAQAPVEQYPGIAVETVTDSSRYFVIRIQDGTGRSAFIGIGFTDRGDAFDFN
VSLQDHFKWVKQESEISKESQEMDNRPKLDLGFKEGQTIKLSIGNITTKKGGVSKPKTTG
AGGLSLLPPPPGGKVTIPPPSSSVAISNHVTPPPIPKSNHGGSDADILLDLDSPAPVPTS
APAPVSASNDLWGDFSTASSSVPNQAPQPSNWVQF
Download sequence
Identical sequences E2RSG2
XP_543832.2.84170 ENSCAFP00000020521 ENSCAFP00000020521 9615.ENSCAFP00000020521

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]