SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000020523 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000020523
Domain Number 1 Region: 336-648
Classification Level Classification E-value
Superfamily PLC-like phosphodiesterases 7.72e-122
Family Mammalian PLC 0.0000000233
Further Details:      
 
Domain Number 2 Region: 177-332
Classification Level Classification E-value
Superfamily EF-hand 2.04e-32
Family EF-hand modules in multidomain proteins 0.00036
Further Details:      
 
Domain Number 3 Region: 654-779
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.93e-29
Family PLC-like (P variant) 0.00013
Further Details:      
 
Domain Number 4 Region: 50-161
Classification Level Classification E-value
Superfamily PH domain-like 6.97e-20
Family Pleckstrin-homology domain (PH domain) 0.0000847
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000020523   Gene: ENSCAFG00000013924   Transcript: ENSCAFT00000022102
Sequence length 782
Comment pep:known_by_projection chromosome:CanFam3.1:9:18400070:18419047:1 gene:ENSCAFG00000013924 transcript:ENSCAFT00000022102 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLCGRWRSRRRRPEEPPGPAQVATPVALAPPDGGSRRPGLRALKKMGLTEDEDVRAMLRG
SRLRKIRSRTWQKERLYRLQEDGLSVWFQRRIPRAPSQHIFFVQHIEAVREGHQSEGLRR
FGGAFPPARCLTIAFRGRRKNLDLAAATAEEAQRWVRGLAKLRARLDAMSQRERLDQHTW
IHAYLHRESDQDSKMSFKEIKSLDTCLHSVVDDRCVHTASPCAFQECDHSNNERLEGAEI
EEFLRRLLKRPELEEIFHRYSGEDRVLSAPELLEFEDQREDGASLAHAQKLIHTYELNET
AKQHELMTLDGFMMYLLSPEGAALDPAHTSVFQDMDQPLSHYFISSSHNTYLTDSQIGGP
SSTEAYVRAFAQGCRCVELDCWEGPGGEPIIYHGHTLTSKILFRDVVQAVHDHAFTLSPY
PVILSLENHCGLEQQAVMARHLRTILGDTLVTQALDAQNPEELPSPEQLKGRVLVKGKKL
PAARSEDGRILSDQEEEEEEEEEEPEATEQRRRAKQISPELSALAVYCCATRLRTLRPTP
VPPQPCQVSSLNERKAKKLIREAGNSFVRHNARQLTRVYPLGLRMNSANYSPQEMWNSGC
QLVALNFQTPGYEMDLNAGRFLVNGQCGYILKPACLRQPDTTFDPECPGPPRTTLTIQVL
TAQQLPKLNTEKPNSIVDPLVRVEIHGVPADCARKETNYVLNNGFNPRWGQTLQFQLRAP
ELVLVRFVVEDYDTTSPNDFVGQFTLPLNSLKQGYRHIHLLSKDGASLSPATLFVHIRIQ
RF
Download sequence
Identical sequences E2RSF7
ENSCAFP00000020523 ENSCAFP00000020523

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]