SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000020729 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000020729
Domain Number 1 Region: 617-685,918-1238
Classification Level Classification E-value
Superfamily Ras GEF 1.57e-111
Family Ras GEF 0.0000125
Further Details:      
 
Domain Number 2 Region: 222-443
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 3.01e-44
Family DBL homology domain (DH-domain) 0.00023
Further Details:      
 
Domain Number 3 Region: 23-128
Classification Level Classification E-value
Superfamily PH domain-like 1.47e-19
Family Pleckstrin-homology domain (PH domain) 0.0051
Further Details:      
 
Domain Number 4 Region: 432-586
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000000067
Family Pleckstrin-homology domain (PH domain) 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000020729   Gene: ENSCAFG00000014053   Transcript: ENSCAFT00000022320
Sequence length 1287
Comment pep:known_by_projection chromosome:CanFam3.1:3:57995031:58085403:1 gene:ENSCAFG00000014053 transcript:ENSCAFT00000022320 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQKGIRLNDGHVASLGLLARKDGTRKGYLSKRSSDNTKWQTKWFALLQNLLFYFESDSSS
RPSGLYLLEGCVCDRAPSPKPALSAKEPLEKQHYFTVNFSHENQKALELRTEDAKDCDEW
VAAIAHASYRTLATEHEALMQKYLHLLQIVETEKTVAKQLRRQIEDGEIEIERLKAEIAS
LLKDNERIQSTQTVTPNDEDSDIKKIKKVQSFLRGWLCRRKWKTIIQDYIRSPHADSMRK
RNQVVFSMLEAEAEYVQQLHILVNNFLRPLRMAASSKKPPITHDDVSSIFLNSETIMFLH
QIFYQGLKARISSWPTLVLADLFDILLPMLNIYQEFVRNHQYSLQILAHCKQNRDFDKLL
KHYEAKPDCEERTLETFLTYPMFQIPRYILTLHELLAHTPHEHVERNSLDYAKSKLEELS
RIMHDEVSETENIRKNLAIERMIIEGCEILLDTSQTFVRQGSLIQVPMSEKGKITRGRLG
SLSLKKEGERQCFLFSKHLIICTRGSGGKLHLTKNGVISLIDCTLLEEPESTEEDAKGSS
QDIDHLDFKIGVEPKDSPPFTVILVASSRQEKAAWTSDISQCVDNIRCNGLMMNAFEENS
KVTVPQMIKSDASLYCDDVDIRFSKTMNSCKVLQIRYASVGRLLERLTDLRFLSIDFLNT
FLHSYRVFTTAVVVLDKLITIYRKPISAIPARSLELLFASGQNNKLLYGDPPKSPRATRK
FSSPPPLSITKTSSPSRRRKLSLNIPIITGGKALDLAALSCSSNGYTSLYSAVSPFSKAT
LDTSKLFVSSSFANKIPDEGETATEKPEEPVALSKQSSEVSVREESDNDQTQSDDGDTEA
SPTKSPTTPKSVKSKNSSEFPLFSYNNGVVMTSCRELDNTRSALSAASAFAIATAGANEG
TPNKEKYRRMSLASTGFPPDQRNGDKEFVIRRAATNRVLNVLRHWVSKHSQDFETNDELR
CKVISFLEEVMHDPELLTQERKAAANIIRTLTQEDPGDNQITLEEITQMAEGVKAEPFEN
HSALEIAEQLTLLDHLVFKKIPYEEFFGQGWMKVEKNERTPYIMKTTKHFNDISNLIASE
IIRNEDINARVSAIEKWVAVADICRCLHNYNAVLEITSSMNRSAIFRLKKTWLKVSKQTK
ALIDKLQKLVSSEGRFKNLREALKNCDPPCVPYLGMYLTDLAFIEEGTPNYTEDGLVNFS
KMRMISHIIREIRQFQQTAYKIEHQVKVSRQCSDPWALTQVLCLDHPLPPSSLHIYPLPF
SLWLPWAQRPTPPGSPPSLLPPSPRHQ
Download sequence
Identical sequences E2RNH2
ENSCAFP00000020729 ENSCAFP00000020729

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]