SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000020796 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000020796
Domain Number 1 Region: 542-788,829-942
Classification Level Classification E-value
Superfamily Oxysterol-binding protein-like 5.23e-131
Family Oxysterol-binding protein 0.00034
Further Details:      
 
Domain Number 2 Region: 9-223
Classification Level Classification E-value
Superfamily Ankyrin repeat 6.84e-42
Family Ankyrin repeat 0.00024
Further Details:      
 
Domain Number 3 Region: 238-345
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000745
Family Pleckstrin-homology domain (PH domain) 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000020796   Gene: ENSCAFG00000014108   Transcript: ENSCAFT00000022395
Sequence length 950
Comment pep:known_by_projection chromosome:CanFam3.1:7:64015959:64222082:1 gene:ENSCAFG00000014108 transcript:ENSCAFT00000022395 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNTEAEQQLLHHARNGNAEEVRQLLETMERNEVIADINCKGRSKSNLGWTPLHLACYFGH
KQVVQDLLKAGAEVNVLNDMGDTPLHRAAFTGRKELVMLLLEYNADATVVNGSGQTAKEV
TYDKEIRNMLEAVERTQQRKLEEELLAAAREGRTAELIALLNRPNPPDVNCSDQLGNTPL
HCAAYRAHKQCALKLLKSGADPNLKNKNDQKPLDLAQGAEMKHILIGNKVVYKVLKRYEG
PLWKSSRFFGWRLFWVVLEHGVLSWYRKQPDAVRNIYRQGCKHLTQAVCTVKSTDSCLFF
IKCFDDTIHGFRVPKNSLQQSREDWLEAIEDHSAYSTHYCSQDQLTDDEEEDTVSSVDLK
ESLEKAQTCQQKLDREISNFLKMIKECDMAKDMLPSFLQKVEVVSEASRETCVALSDCLN
LFTKQEGVRNFKLEQEQEKNKILSEALETLATEHHELERSLVEGSPPRSILSEDEFYDAL
SESESEWSLSRLEAVTACSLDEKGEHLSSRKHRMSEGKDCGGGDALSNGIKKHRTSLPSP
MFSRNDFSIWSILRKCIGMELSKITMPVIFNEPLSFLQRLTEYMEHTYLIHKASSFSDSV
ERMQCVAAFAVSAVASQWERTGKPFNPLLGETYELVRDDLGFRLISEQVSHHPPISAFHA
EGLNNDFIFHGSIYPKLKFWGKSVEAEPKGTITLELLEHSEAYTWTNPTCCVHNIIVGKL
WIEQYGNVEITNHKTGDKCVLNFKPCGLFGKELHKVEGYIQDKSKKKLCALYGKWTECLY
SVDPATFDAYKKNDKKNTEEKKNSKQMSTSEESDEMPMPDSESVFVIPGSVLLWRIAPRP
PNSAQMYNFTSFAMVLNEVDKDMESLIPKTDCRLRPDIRAMENGEIDQASEEKKRLEEKQ
RAARKNRSKSEEDWKTRWFHQGPNPYNGAQDWLYSGSYWDRNYFNLPDIY
Download sequence
Identical sequences E2RMD4
ENSCAFP00000020796 XP_005623056.1.84170 XP_537881.2.84170 ENSCAFP00000020796 9615.ENSCAFP00000020796

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]