SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000020966 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000020966
Domain Number 1 Region: 326-519
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 2.55e-53
Family BCR-homology GTPase activation domain (BH-domain) 0.00012
Further Details:      
 
Domain Number 2 Region: 50-152
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000000106
Family Pleckstrin-homology domain (PH domain) 0.012
Further Details:      
 
Domain Number 3 Region: 164-243
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000000000169
Family Ras-binding domain, RBD 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000020966   Gene: ENSCAFG00000014221   Transcript: ENSCAFT00000022580
Sequence length 1159
Comment pep:known_by_projection chromosome:CanFam3.1:5:22249219:22367462:1 gene:ENSCAFG00000014221 transcript:ENSCAFT00000022580 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SQQKMKTLAERRRSAPSLILDKALQKRPSTKESPSASVDTCTFLSSFVCSSRTLLIDGRV
ELKRGLQRQERHLFLFNDLFVVAKIKYNNNFKIKNKIKLCDMWTASCVDEVGEGNTNATK
SFVLGWPTVNFVATFSSPEQKDKWLSLLQRYINLEKEKDYPKSIPLKIFAKDIGNCAYSK
TITVTNSDTANEVINMSLPMLGITGSERDYQLWVNSGKEEAPYPLIGHEYPYGIKMSHLR
DTMVLTQGSKGSSAPSSLQESLLTEQLPREAQCQFILKPSRLAAAQQLSDSGQKTFKRRR
SIINWAFWRGSSTHLDNLPVSPTSPMPGQLFGVSLPNICENDNLPKHVLDMLFFLNQKGP
LTKGIFRQSANVKSCRELKEKLNSGVEVHLDCESVFVIASVFKDFLRNIPGSIFSSDLYD
QWVCVMDQGNDEERINTIQRLLDQLPRANVVLLRYLFGLLHNIEQRSSSNQMTAFNLAVC
IAPSILWPPTSSSPELENEFTKKVSLLIQFLIENCCRIFGEEITSLLGQVSVRCDTRENA
SDISCFQLNDSSYDSLENELNEDVDAPCSDLVKKLGQGSRSMDSVLTLSDYDLDQPEVEG
LLTLSDFDLDRSKDEDIQMERPLESKPVNIAVVYTKVPLRDHARAPSGMSTPSYLSTAAA
DVPKSLRRHRRCSEPSIDYLDSKLSYLREFYQKKLRKSSCDAILSQKDEDYLKQNQPLQE
EGKTYFKQSLVAGTDNKKNATNKNVKKKSLSGGEGNHMKLFSKSKPVAISVASYSHMSSQ
DHPRNQPFGADTSGYSPPHAADAIKGSRRHRRCSEPNMDDQHCKLTYLRGIYSKKQHKTS
YEAGLFHGEEDYLKRHKSLQMEGQKLINQSLVMGIEVGKSSGTNQNPEKGLPPRLNLCPR
TSYSSLSSPGTSPSGSSVSSQDSAFSQISEHSVFTPTETSSPIDCTFQAQRKQEELSSDF
SNSSLISATPGPSSGQASSHLAYMKKDTVEWHSQIHSVTLHPSTWLRNGVASLKNWSLKK
KTRVCRPEEKKVISLKGPTEQPPHAPGISEASPLPERQKDMLQRAPEELGTVQTAQWYSS
YPSQDSERHCSSPFSLVEDGLKLCVKSHKDEENNEQCSPGSLSCRRSSPSSLSVDDVSSP
NLGPTMVSDPGDQHLAKDI
Download sequence
Identical sequences F1PP74
ENSCAFP00000020966 ENSCAFP00000020966

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]