SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000021080 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000021080
Domain Number 1 Region: 537-1009
Classification Level Classification E-value
Superfamily Ras GEF 1.26e-135
Family Ras GEF 0.000000000000373
Further Details:      
 
Domain Number 2 Region: 1-149
Classification Level Classification E-value
Superfamily Histone-fold 6.81e-46
Family TBP-associated factors, TAFs 0.00000118
Further Details:      
 
Domain Number 3 Region: 179-365
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 4.45e-40
Family DBL homology domain (DH-domain) 0.000000218
Further Details:      
 
Domain Number 4 Region: 388-544
Classification Level Classification E-value
Superfamily PH domain-like 6.43e-37
Family Pleckstrin-homology domain (PH domain) 0.00000176
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000021080   Gene: ENSCAFG00000014275   Transcript: ENSCAFT00000022697
Sequence length 1304
Comment pep:known_by_projection chromosome:CanFam3.1:8:26638077:26698818:-1 gene:ENSCAFG00000014275 transcript:ENSCAFT00000022697 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KVQEQVHPNLSANEESLYYIEELIFQLLNKLCMAQPRTVQDVEERVQKTFPHPIDKWAIA
DAQSAIEKRKRRNPLLLPVDKIHPSLKEVLGYKVDYHVSLYIVAVLEYISADILKLAGNY
VFNIRHYEISQQDIKVSMCADKVLMDMFDQDDIGLVCLCEDEPSSSGELNYYDLVRTEIA
EERQYLRELNMIIKVFREAFLSDRNLFKPSDIDRIFSNISDIHELTVKLLGLIEDTVEMT
DESSPHPLAGSCFEDLAEEQAFDPYETLSQDILSPKFNEHFSKLMARPAVALHFQSIADG
FKEAVRYVLPRLMLVPVYHCWHYFELLKQLKACSEEQEDRECLNQAITALMNLQGSMDRI
YKQYSPRRRPGDPVCPFYNRQLRSKHLAIKKMNEIQKNIDGWEGKDIGQCCNEFIMEGPL
TRIGAKHERHIFLFDGLMISCKPNHSQSRLPGYSNAEYRLKEKFIMRKTQICDKEDTCEC
KHAFELISKDENSIIFAAKSAEEKNNWMAALISLHYRSTLDRMLDSVLLKEENEQPLRLP
SPEVYRFVVKDSEENIVFEDNLQSRSGIPIIKGGTVVKLIERLTYHMYADPNFVRTFLTT
YRSFCKPQELLSLLIERFEIPEPEPTEADKLAVEKGEQPISADLKRFRKEYVQPVQLRIL
NVFRHWVEHHFYDFERDLELLERLESFISSVRGKAMKKWVESIAKIIKRKKQAQANGISH
NITFESPPPPIEWHISRPGQFETFDLMTLHPIEIARQLTLLESDLYRKVQPSELVGSVWT
KEDKEINSPNLLKMIRHTTNLTLWFEKCIVEAENFEERVAILSRIIEILQVFQDLNNFNG
VLEIVSAVNSVSVYRLDHTFEALQERKRRILDEAVELSQDHFKKYLVKLKSINPPCVPFF
GIYLTNILKTEEGNNDFLKKKGKDLINFSKRRKVAEITGEIQQYQNQPYCLRIEPEMRRF
FENLNPMGNASEKEFTDYLFNKSLEIEPRNCKQPPRFPRKSTFSLKSPGIRPNTGRHGST
SGTLRGHPMPLEREPYKISFSRIAETDLESTVSAPTSPNTPSTPPVSASSDLSVFLDVDL
NSSCGSNSIFAPVLLPHSKSFFSSCGSLHKLSEEPLIPPPLPPRKKFDHDASNSKGNTKS
DDDPPAIPPRQPPPPKVKPRVPAPTGAFDGPLHSPPPPPPRDPLPDTPPPVPLRPPEHFI
NCPFNLQPPPLGHLHRDPDWFRDVSTCPNSPNTPPSTPSPRVPRRCYLLSSSHNNLAHPQ
APPVPPRQNSSPHLPKLPPKTYKRELSHPPSYRLPLLENAETPQ
Download sequence
Identical sequences F1P859
ENSCAFP00000021080 9615.ENSCAFP00000021080 ENSCAFP00000021080

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]