SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000021264 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000021264
Domain Number 1 Region: 345-548
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.19e-54
Family Nucleotide and nucleoside kinases 0.0000136
Further Details:      
 
Domain Number 2 Region: 203-335
Classification Level Classification E-value
Superfamily SH3-domain 7.09e-33
Family SH3-domain 0.0014
Further Details:      
 
Domain Number 3 Region: 117-220
Classification Level Classification E-value
Superfamily PDZ domain-like 1.45e-16
Family PDZ domain 0.001
Further Details:      
 
Domain Number 4 Region: 65-118
Classification Level Classification E-value
Superfamily L27 domain 0.000000000000171
Family L27 domain 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000021264   Gene: ENSCAFG00000014402   Transcript: ENSCAFT00000022892
Sequence length 552
Comment pep:known_by_projection chromosome:CanFam3.1:9:19411582:19441081:1 gene:ENSCAFG00000014402 transcript:ENSCAFT00000022892 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPVAATNSESAMQQVLDNLGSLPNATGAAELDLIFLRGIMESPIVRSLAKAHERLEETKL
EAVRDNNLELVQEILRDLAQLAEQSSTAAELARILQEPHFQSLLETHDSVASKTYETPPP
SPGLDPTFSNQPVPPDAVRMVGIRKTAGEHLGVTFRVEGGELVIARILHGGMVAQQGLLH
VGDIIKEVNGQPVGSDPRALQELLRSASGSVILKILPSYQEPHLPRQVFVKCHFDYDPAR
DSLIPCKEAGLRFSAGDLLQIVNQDDANWWQACHVEGGSAGLIPSQLLEEKRKAFVKRDL
ELTPTSGTLCGSLSGKKKKRMMYLTTKNAEFDRHELLIYEEVARMPPFRRKTLVLIGAQG
VGRRSLKNKLIMWDPDRYGTTVPYTSRRPKDSEREGQGYSFVSRSEMEADIRAGRYLEHG
EYEGNLYGTRIDSIRGVVAAGKVCVLDVNPQAVKVLRTAEFVPYVVFIEAPDFETLRAMN
RAALESGVSTKQLTEADLRRTVEESSRIQRGYGHYFDLSLVNTNLERTFRELQAAMEKLR
TEPQWVPVSWVY
Download sequence
Identical sequences E2RLD5
XP_013972007.1.84170 XP_548068.2.84170 ENSCAFP00000021264

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]