SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000021285 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000021285
Domain Number 1 Region: 383-581
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.71e-41
Family Nucleotide and nucleoside kinases 0.00024
Further Details:      
 
Domain Number 2 Region: 181-312
Classification Level Classification E-value
Superfamily SH3-domain 2.14e-23
Family SH3-domain 0.0011
Further Details:      
 
Domain Number 3 Region: 133-217
Classification Level Classification E-value
Superfamily PDZ domain-like 7.76e-20
Family PDZ domain 0.0012
Further Details:      
 
Domain Number 4 Region: 67-118
Classification Level Classification E-value
Superfamily L27 domain 0.0000000000000288
Family L27 domain 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000021285   Gene: ENSCAFG00000023403   Transcript: ENSCAFT00000022916
Sequence length 585
Comment pep:known_by_projection chromosome:CanFam3.1:9:19478589:19504401:1 gene:ENSCAFG00000023403 transcript:ENSCAFT00000022916 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPVLSEDSGLHETLALLTSQLRPDSNHKEEMGFLRDVFSEKSLSYLMKIHEKLRYYERQS
PTPVLHSAMALAEDVMEELQAASVHSDERELLQLLSTPHLRAMLMVHDTVAQKNFDPVLP
PLPDNIDEDFDEESVKIVRLVKNKEPLGATIRRDEHSGAVVVARIMRGGAADRSGLVHVG
DELREVNGIAVLHKRPDEISQILAQSQGSITLKIIPATQEEDRLKDSKVFMRALFHYNPR
EDRAIPCQEAGLPFQRRQVLEVVSQDDPTWWQAKRVGDTNLRAGLIPSKQFQERRLSYRR
ATGTLPSPQNLRKPPYDQPCDKEACDCEGYLKGHYVAGLRRSFRLGRRERLGSPQEGKAS
VVAESPELLTYEEVTRYQHQPGERPRLVVLIGSLGARLHELKQKVVAENPQHFGVAVPHT
TRPRKSHEKEGVEYHFVSKQAFEADLHHNKFLEHGEYKENLYGTSLDAIQSVMAKNKVCL
VDVEPDSTTGLRLCFFKVFLSEEANPMQAEQRKPRGLPVLECQGLVFDEEQQEMAASAAF
IDQYYGHLVDSVLVKQDLQSAHSQLRVLLEKLSKDTHWVPVSWVR
Download sequence
Identical sequences E2RKJ2
ENSCAFP00000021285

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]