SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000021446 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000021446
Domain Number 1 Region: 14-388
Classification Level Classification E-value
Superfamily Serpins 1.28e-109
Family Serpins 0.000000287
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000021446   Gene: ENSCAFG00000014536   Transcript: ENSCAFT00000023097
Sequence length 408
Comment pep:known_by_projection chromosome:CanFam3.1:34:32331034:32357268:-1 gene:ENSCAFG00000014536 transcript:ENSCAFT00000023097 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CTEVKMNKILLWSLLLIFSGSQASRPLVQRNVEFAVDLYQTICLSHENNIIFSPLGTTLV
LGMIQLGAKGRAQQQIRQTLKLQENSTGEEFSVLKSFFSAISEKKQEFTFNLANALYLQE
GFTVKEQYLHSNKEFFQSAIKLVDFQDAKTSAETISTWVESKTDGKIKDMFSGEDFGPLT
RLVLVNAIYFKGDWKQKFRKEDTQLTNFTKKDGAAVKIPMMKALLRTKYGYFSEPSMNYQ
VLELPYKGDGFSLIIILPAEDVNIEEMEKRITAHQILKWFSEMQEEEVEVSLPSRFKVEQ
KLDFKEALYSLNMTEVFSGGCDLSGITDSAEVFVSQVMQHIFFEINEDGSEAATATGMHI
PAIMSLAHNQFIANHPFLFIVKNNPTGIFSRILWGNCLSQTDLVLAAI
Download sequence
Identical sequences E2RAP8
ENSCAFP00000021446 ENSCAFP00000021446

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]