SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000021460 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000021460
Domain Number 1 Region: 318-490,534-707
Classification Level Classification E-value
Superfamily PLC-like phosphodiesterases 2.84e-131
Family Mammalian PLC 0.00000000246
Further Details:      
 
Domain Number 2 Region: 148-314
Classification Level Classification E-value
Superfamily EF-hand 2.39e-50
Family EF-hand modules in multidomain proteins 0.00000959
Further Details:      
 
Domain Number 3 Region: 17-146
Classification Level Classification E-value
Superfamily PH domain-like 7.99e-43
Family Pleckstrin-homology domain (PH domain) 0.0000322
Further Details:      
 
Domain Number 4 Region: 728-841
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 2.83e-23
Family PLC-like (P variant) 0.0000376
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000021460   Gene: ENSCAFG00000014542   Transcript: ENSCAFT00000023114
Sequence length 919
Comment pep:known_by_projection chromosome:CanFam3.1:18:52724096:52808954:-1 gene:ENSCAFG00000014542 transcript:ENSCAFT00000023114 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGARPGVHALQLEPPTVVETLRRGSKFIKWDEETSSRNLVTLRVDSNGFFLYWTGPNME
VDTLDISSIRDTRTGRYSRLPKDPKIREVLGFGGPDTRLEEKLMTVVAGPDPVNTTFLNF
MAVQDDTAKVWAEELFKLAMNILAQNASRNTFLRKAYTKLKLQVNQDGRIPVKNILKMFS
ADKKRVETALESCGLNFNRSESIRPDEFSLEIFERFLNKLCLRPDIDKILLEIGAKGKPY
LTLEQLMDFINQKQRDPRLNEVLYPPLRPSQARLLIEKYEPNQQFLERDQMSMEGFSRYL
GGEENGILPLEALDLSADMTQPLSAYFINSSHNTYLTAGQLAGTSSVEMYRQALLWGCRC
VELDVWKGRPPEEEPFITHGFTMTTEVPLRDVLEAIAETAFKTSPYPVILSFENHVDSAK
QQAKMAEYCRSIFGDALLIDPLDKYPLAPGVPLPSPQDLMGRILVKNKKRHQPSTGVPNS
SVRKRPLEQSNSALSESSATTDPSSPQLGSPSSESCPGLSNGEEVGLEKPSLEPQKSLGE
DGLPRGPNTLGSADREDEEEEEEEEEQADPKKPTSDEGTASSEVNATEEMSTLVNYIEPV
KFKSFEAARKRNKCFEMSSFVETKAMEQLTKSPMEFVEYNKQQLSRIYPKGTRVDSSNYM
PQLFWNVGCQLVALNFQTLDVAMQLNAGVFEYNGRSGYLLKPEFMRRPDKSFDPFTEVIV
DGIVANALRVKVISGQFLSDRKVGIYVEVDMFGLPVDTRRKYRTRTSQGNSFNPVWDEEP
FDFPKVVLPTLASLRIAAFEEGGKFVGHRILPVSAIRSGYHYICLRNEANQPLCLPALLI
YTEASDYIPDDHQDYAEALINPIKHVSLMDQRAKQLAALIGESEVSQGRSGMGRQQAQDF
TSGSAASSPCSLAASPRRP
Download sequence
Identical sequences E2R9U6
ENSCAFP00000021460

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]