SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000021511 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000021511
Domain Number 1 Region: 16-397
Classification Level Classification E-value
Superfamily Serpins 2.88e-116
Family Serpins 0.0000000000578
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000021511   Gene: ENSCAFG00000014582   Transcript: ENSCAFT00000023167
Sequence length 410
Comment pep:known_by_projection chromosome:CanFam3.1:34:32597837:32624469:1 gene:ENSCAFG00000014582 transcript:ENSCAFT00000023167 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAFLGLFSLLVLQSLALAATFPDETIAELSVNMYNHLRATGEDENILFSPLSVTFAMGMM
ELGAQGSTLKEIRHSMGYDSLKNGDEFSFLKDFSNMVTAKESQYVMKIANSLFVQNGFHV
NEEFLQMLKKYFKAEVNHVDFSQNIAVANLVNKWVENNTNNLLKDLVSPRDFDAGTHLAL
INAVYFKGNWKSQFRPENTRTFSFTKDDESEVQIPMMYQQGEFYYGEFSDGSNEAGGIYQ
VLEIPYEGDEISMMLVLSRQEVPLATLEPLVKAQLIEEWANSVKKQKVEVYLPRFTVEQE
IDLKEVLKALGITEVFIKNANLTALSDNKEIFLSKAIHKSFIEVNEEGSEAAATSGMIAI
SRMAVLYPQVIVDHPFFFLIRNRRTGTVLFMGRVMHPETMNTSGHDFEEL
Download sequence
Identical sequences E2RLA3
ENSCAFP00000021511 ENSCAFP00000021511 XP_005639945.1.84170 XP_535853.3.84170

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]