SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000021528 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000021528
Domain Number 1 Region: 1544-1686
Classification Level Classification E-value
Superfamily PH domain-like 1.26e-51
Family Phosphotyrosine-binding domain (PTB) 0.000000442
Further Details:      
 
Domain Number 2 Region: 179-306
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 3.27e-40
Family PLC-like (P variant) 0.0026
Further Details:      
 
Domain Number 3 Region: 12-177
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.77e-31
Family Dual specificity phosphatase-like 0.00011
Further Details:      
 
Domain Number 4 Region: 1413-1476,1504-1533
Classification Level Classification E-value
Superfamily SH2 domain 2.02e-19
Family SH2 domain 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000021528   Gene: ENSCAFG00000014575   Transcript: ENSCAFT00000023184
Sequence length 1692
Comment pep:known_by_projection chromosome:CanFam3.1:37:24583507:24669980:-1 gene:ENSCAFG00000014575 transcript:ENSCAFT00000023184 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSVSRTMEDSCELDLVYVTERIIAVSFPSTANEENFRSNLREVAQMLKSKHGGSYLLFNL
SERRPDITKLHAKVLEFGWPDLHTPALEKICSVCKAMDTWLNADPHNVVVLHNKGNRGRI
GVVIAAYMHYSNISASADQALDRFAMKRFYEDKIVPIGQPSQRRYVHYFSGLLSGSIKMN
NKPLFLHHVIMHGIPNFESKGGCRPFLRIYQAMQPVYTSGIYNVQGDSQTSICITIEPGL
LLKGDILLKCYHKKFRSPARDVIFRVQFHTCAIHDLGVVFGKEDLDDAFKDDRFPEYGKV
EFVFSYGPEKIQGMEHLENGPSVSVDYNTSDPLIRWDSYDNFDGHREDGMEEVVGHTQGP
LDGSLYAKVKKKDSLHGSTGAVNATRPALSATPNHVEHTLSVSSDSGNSTASTKTDKTDE
PAPGPSSAPAALSPEEKRELDRLLSGFGVEREKQGAMYHPQHLRSRPAGGPAVPSSGRHV
VPAQVHVNGGALASERETDILDDELPNQDGHSVGSMGTLSSLDGVTNTSEGGYPEALSSL
TNGLDKPYPVEPMVNGGAYPYESASRMAPAHAAHVAPMRPSYSAQEGLAGYQREGPHPAW
PQPVTTSHYGHDPSSMFRSQSFPESEPQLPPAPARGGSSREAVQRGLNSWQQQQQQQQQQ
PRPPPRQQERAHLESLGPSRPSPQPSAETPTPGLPEFPRAASQQEIEQSIEALNMLMLDL
EPATASAPLHKSQSVPGAWPGASPLSSQPLSGSSCQPHPLTQSRSGYIPSGHSLGTPELA
PRASLAVESFPPGRPYSPYDYQPCPAGSSQSFRPKSPASSSSAFLSTTQSPPGPQQPPAS
LPGLTAQPPLPPKEATSDPSRTPEEEPLNLEGLVAHRVAGVQAREKQPAEPPAPLRRRAA
SDGQYENQSPEPGSPRSPGVRSPVQCVSPELALTIALNPGGRPKEPHLHSYKEAFEEMEG
TSPTSPPPSGGTVRSPPGLAKTPLSALGLKPHNPADILLHPTGEPRSYVESVVRTAVAGP
RAQDPEPKSFSAPAAQAYGHDTPLRNGTLGGSFVSPSPLSTSSPILSADSTSVGSFPSGE
SSDQGPRTPTQPLLDSGFRSGSLGQPSPSAQRSYQSSSPLPTVGSSYGSPDYSLQQFSSP
ESQARPQFTVAGVHPVPGSPQARHRTVGTNTPPSPGFGRRAFNPSVAAPGSPSLSHRQAM
GPAGTAFHGSTVSSPQSSAATTPGSPSLARHPGAHPGGLASGVHGSALGSPGSPSLGRHL
GAQGPGLPGSPGLERHAAYGGYSTPEDPRPALSRQSSASGYQAPSTPSFPVSPAYYPGLS
SPATSPSPDSAAFRQGSPTPALPEKRRMSVGDRAGSLPNYATVNGKVSSSPVASGMSSPS
GGSTVSFSHTLPDFSKYSLPDNSPETRAKVKFVQDTSKYWYKPEISREQAIALLKDQEPG
AFIIRDSHSFRGAYGLAMKVSSPPPTIMQQNKKGSTLSSSRVQDQVETGPRGVKLKGCPN
EPNFGSLSALVYQHSIIPLALPCKLVIPNRDPTDESKDSSGPANSTTDLLKQGAACNVLF
VNSVDMESLTGPQAISKAASETLAADPTPAATIVHFKVSAQGITLTDNQRKLFFRRHYPL
NTVTFCDLDPQERKWMKTEGGVPAKLFGFVARKQGSTTDNACHLFAELDPNQPASAIVNF
VSKVMLSAGQKR
Download sequence
Identical sequences E2RL77
ENSCAFP00000021528 ENSCAFP00000021528

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]