SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000021767 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000021767
Domain Number 1 Region: 345-599,715-765
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 8.06e-69
Family Protein kinases, catalytic subunit 0.00000000231
Further Details:      
 
Domain Number 2 Region: 24-132
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 2.36e-30
Family Vacuolar sorting protein domain 0.0087
Further Details:      
 
Domain Number 3 Region: 1260-1414
Classification Level Classification E-value
Superfamily Cyclin-like 0.0000000000794
Family Cyclin 0.019
Further Details:      
 
Domain Number 4 Region: 127-164
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.00000000049
Family Vacuolar sorting protein domain 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000021767   Gene: ENSCAFG00000014776   Transcript: ENSCAFT00000023438
Sequence length 1566
Comment pep:known_by_projection chromosome:CanFam3.1:9:20215419:20247344:-1 gene:ENSCAFG00000014776 transcript:ENSCAFT00000023438 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RSGGRKSFARRFRVSWATTMAMSFEWPWQYRFPPFFTLQPNVDTRQKQLAAWCSLVLSFC
RLHKQSSMTVMEAQESPLFNNVKLQRRKLPVESIQVVLEELRKKGICFAGNLEWLDKNKS
SFLIMWRRPEEWGKLIYQWVSRSGQNNSVFTLYELTNGEDTEDEAPPTSETAVPMSQAEA
DLGLRPPPPLAAAAAAAAGPPRLGPPPRRARRFSGKAEPRPRSSRLSRRSSVDLGLLSLW
SQPASPVPEPPDPPDSAGAGPARSPPPSRPEPPEGTWTGGAPVKAADSTRPELPGSTGGP
GGRDPQTAPEAAARERQREQEEKEDTETQAVATSPDGRYLKFDIEIGRGSFKTVYRGLDT
DTTVEVAWCELQTRKLSRTERQRFSEEVEMLKGLQHPNIVRFYDSWKSVLRGQVCIVLVT
ELMTSGTLKTYLRRFREMKPRVLQRWSRQILRGLHFLHSRVPPILHRDLKCDNVFITGPS
GSVKIGDLGLATLKRASFAKSVIGTPEFMAPEMYEEKYDEAVDVYAFGMCMLEMATSEYP
YSECQNAAQIYRKVTSGTKPNSFYKVKMPEVKEIIEGCIRTDKNERFTIQDLLAHAFFRE
ERGVHVELAEEDDGEKPGLKLWLRMEDARRGGRPRDNQAIEFLFQLGRDAAEEVAQEMVA
LGLVCEADYQPVARAVRERVAAIQRKREKLRKARELEALPPAPGPQAATVPMTPGPPSVF
PHEPEEPEADQHQPFLFRHASYSSTTSDCETDGYLSSSGFLDASDPAFQPPGGVPSSPAE
SHLCLPSAFALSIPRSGPGSDFSPGDRHSYLLFSSSYASDAASGLSDVGEGMACMRRPPG
RNLRRRPRSRLRVTSVSDQNDRVVECQLQTHNSKMVTFRFDLDGDSPEEIAAGLVYNEFI
LPSERAGFLSRIREIIQRVETLLKRDTGPVEAAEDPLGPQEEPVPLPALSSPLPDQSCEG
KPQLVGRFQVTSSKEPAEPLPLQPALPTLSSSLKPPTPQLTSESSTEDSAGIGPEKEALA
ESDRAAEGLGAGVEEEGDDGKEPRVGGSPPPHSHPSPVWMNYSYSSLCLSSEESESSGED
EEFWAQLQSLRQKHLSEVEALQTLQKKEIEDLYSRLGKQPPPGIVAPAAMLSSRQRRLSK
GSFPTSRRNSLQRSEPLGPGIMRRNSLSGSSTGSQEQRASKGVTFAGDVGRMVRAGPRRA
HRRGRRIQSVAEDSGVKLRGSVYGSSEPSRCPQMFLKMDGPVRSRPASLSDFQFGAVATE
TIEDALLHLVQQNEQAMQEAAGRMGSFRETRIVEFVFLLSEQWCLEKSVSYQAVEILERF
MIKQAENMYRQATIQLREKKEPQNWKALKEQLFNKFILRLVSCVQLASKLSFHYKIISNI
TVLNFLQSLGYVHTKEELLESELDVLKSLNFQINLSTPLAYVEMLLEVLGYNGCLVPATR
LHATCLTLLDLVYLLREPIYESLLRASIENPIPSQLQGEKFVSVKEDFMLLAVGIIAASA
FIQNHECWSQVVGHLQSITGIALESIAEFSYAILTHSVGANTPRRQQPVLPHLEARALRA
AASSNT
Download sequence
Identical sequences E2RNW6
ENSCAFP00000021767 ENSCAFP00000021787

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]