SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000021816 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000021816
Domain Number 1 Region: 3-153
Classification Level Classification E-value
Superfamily PH domain-like 3.58e-49
Family Phosphotyrosine-binding domain (PTB) 0.00044
Further Details:      
 
Weak hits

Sequence:  ENSCAFP00000021816
Domain Number - Region: 162-196
Classification Level Classification E-value
Superfamily Mitotic arrest deficient-like 1, Mad1 0.00615
Family Mitotic arrest deficient-like 1, Mad1 0.0086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000021816   Gene: ENSCAFG00000014796   Transcript: ENSCAFT00000023491
Sequence length 304
Comment pep:known_by_projection chromosome:CanFam3.1:36:30108886:30250892:1 gene:ENSCAFG00000014796 transcript:ENSCAFT00000023491 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNRAFSRKKDKTWMHTPEALSKHYIPYNAKFLGSTEVEQPKGTEVVRDAVRKLKFARHIK
KSEGQKIPKVELQISIYGVKILEPKTKEVQHNCQLHRISFCADDKTDKRIFTFICKDSES
NKHLCYVFDSEKCAEEITLTIGQAFDLAYRKFLESGGKDVETRKQIAGLQKRIQDLEAEN
MELKNKVQDLESQLRVTQVSTSPAGSVTPKSPSTDIFDMIPFSPVSHPSSTPTRNGTQPP
PIPSRSTEIKRDLFGAEPFDPFNCGAGDFPPDIQSKLDEMQEGFKMGLTLEGTVFCLDPL
DSRC
Download sequence
Identical sequences E2RK11
ENSCAFP00000021816 XP_013966283.1.84170 9615.ENSCAFP00000021816 ENSCAFP00000021816

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]