SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000021819 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000021819
Domain Number 1 Region: 164-349
Classification Level Classification E-value
Superfamily PH domain-like 1.37e-56
Family Phosphotyrosine-binding domain (PTB) 0.000000384
Further Details:      
 
Domain Number 2 Region: 513-614
Classification Level Classification E-value
Superfamily SH2 domain 7.14e-26
Family SH2 domain 0.0000163
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000021819   Gene: ENSCAFG00000014794   Transcript: ENSCAFT00000023496
Sequence length 632
Comment pep:known_by_projection chromosome:CanFam3.1:30:15056558:15188468:-1 gene:ENSCAFG00000014794 transcript:ENSCAFT00000023496 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRRRGRDSLAGLVLCVGLVGHPGMLHRAKYSRFRNESVTSLDESGPGGGAGGDKGSPQPP
YPALAPHLPPEDATLAAQESPTPLCTLIPRMASVKLANPATLLSLKNFCLGTKEVPRLKL
QESQDPAPSSPAPPEAGLTRAGPAPLPQQPGPVGHRATVLTPEACPLPGAGQPTPGSRQD
RHFLQHLLGMGMNYYVRYMGCIEVLQSMRSLDFGMRTQVTREAISRLCEAVSGANGAVKK
RKPPVKFLSTVLGKSNLQFSGMNIKLTISTCSLTLMNIDNQQIIANHHMQSISFASGGDP
DTTDYVAYVAKDPVNQRACHILECRSGMAQDVISTIGQAFELRFKQYLKNPSLNTSCESE
GVPIDDHAEEREDHEYYNEIPGKQPPAGGVSDVRIKVQATEQMAYCPIRCEKLCYLPGNS
KCSSVYENCLEQSRAIGNAQERGVQSHRDASLMKHACRVDFFNDPCYINTQAFQSTLGSA
PNQSSAHVLGSPWHREKAPETVQPGATAQPASSHSLPHVKQQLRSEDCYHGKLSRKAAES
LLVKDGDFLVRESATSPGQYVLSGLQGGQAKHLLLVDPEGKVRTKDHVFDNVGHLIRYHM
DNSLPIISSGSEVSLKQPVRKDNNPGLLHSNK
Download sequence
Identical sequences E2RK06
9615.ENSCAFP00000021819 XP_544671.2.84170 ENSCAFP00000021819 ENSCAFP00000021819

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]