SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000022023 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000022023
Domain Number 1 Region: 359-552
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 9.52e-30
Family Nucleotide and nucleoside kinases 0.00092
Further Details:      
 
Domain Number 2 Region: 193-343
Classification Level Classification E-value
Superfamily Nucleotidylyl transferase 0.00000000000394
Family Cytidylyltransferase 0.065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000022023   Gene: ENSCAFG00000014948   Transcript: ENSCAFT00000023725
Sequence length 564
Comment pep:known_by_projection chromosome:CanFam3.1:9:20396555:20399982:-1 gene:ENSCAFG00000014948 transcript:ENSCAFT00000023725 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAVFRSGLLVLTTPLASLAPRLAPILTSAARLVNHTLYVHLQPGMSLGGPAQPQSSVVQA
TFEVLDFITHLYAGADVHRHLDVRVLLTNIGAKSAFLPPLSSSVQNLAHPPEVVLTDFQT
LDGSQYNPVKQQLERYATSCYSCCPQLASVLLYPDYGPEELPTEPLDVLLPSTIRPASPV
ARSPKQPVRGYHRGAVGGTFDRLHNAHKVLLSVACVLAQEQLVVGVADKDLLKSKLLPEL
LQPYTERVEHLSEFLVDIKPSLTFDIIPLLDPYGPAGSNPSLEFLVVSEETYRGGMAVNR
FRLENDLEELALYQIQLLKDQSHQDNEEDKVSSSSFRQRMLGNLLQPPYKRPELPTQLYV
IGLTGISGSGKSSVAQRLKGLGAFIIDSDHLGHRAYAPGGPAYQPVVEAFGTDILHKDGI
INRKVLGSRVFGNKKQLKILTDIMWPVIAKLAREEMDQAVAEGKHVCVIDAAMLLEAGWQ
NMVHEVWTVVIPETEAIRRIVERDGLSEAAAQSRLQSQMSGQQLVDQSHVVLSTLWEPHV
TQRQVEKAWTLLQKRIPRTSLGLE
Download sequence
Identical sequences E2RIA4
ENSCAFP00000022023

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]