SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000022072 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000022072
Domain Number 1 Region: 611-716
Classification Level Classification E-value
Superfamily SH2 domain 4.85e-32
Family SH2 domain 0.00000331
Further Details:      
 
Domain Number 2 Region: 321-425
Classification Level Classification E-value
Superfamily SH2 domain 3.5e-29
Family SH2 domain 0.00000237
Further Details:      
 
Domain Number 3 Region: 105-261
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.37e-17
Family BCR-homology GTPase activation domain (BH-domain) 0.00026
Further Details:      
 
Domain Number 4 Region: 5-82
Classification Level Classification E-value
Superfamily SH3-domain 0.000000000000024
Family SH3-domain 0.0000988
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000022072   Gene: ENSCAFG00000014978   Transcript: ENSCAFT00000023779
Sequence length 726
Comment pep:known chromosome:CanFam3.1:20:44825948:44836136:-1 gene:ENSCAFG00000014978 transcript:ENSCAFT00000023779 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGAEGFQYRALYPFRRERPEDLELLPGDVLVVSRAALQVLGVAEGNERCPQSVGWMPGL
NERTRQRGDFPGTYVEFLGPVALARPGPRPRGPRPLPARPRDGPPEPGLTLPDLPEQFSP
PDVAPPLLVKLVEAIERTGLDSESLYRPELPAPRTDWSLSDVEQWDAAALTDGVKSFLLA
LPAPLVTPEAAAEARRALREAAGPVGPALEPPTLPLHRALTLRFLLQHLGRVARRAPAPG
PAVRALGATFGPLLLRAPPPSPPPGGAPDGTEPSPDFPVLLVEKLLQEHLEEQEVTPPAL
PPKPPKAKPAPAGLANGGSPPSLQDAEWYWGDISREEVNEKLRDTPDGTFLVRDASSKIQ
GEYTLTLRKGGNNKLIKVFHRDGHYGFSEPLTFCSVVDLITHYRHESLAQYNAKLDTRLL
YPVSKYQQDQIVKEDSVEAVGAQLKVYHQQYQDKSREYDQLYEEYTRTSQELQMKRTAIE
AFNETIKIFEEQGQTQEKCSKEYLERFRREGNEKEMQRILLNSERLKSRIAEIHESRTKL
EQELRAQASDNREIDKRMNSLKPDLMQLRKIRDQYLVWLTQKGARQKKINEWLGIKNETE
DQYALMEDEDDLPHHEERTWYVGKINRTQAEEMLSGKRDGTFLIRESSQRGCYACSVVVD
GDTKHCVIYRTATGFGFAEPYNLYGSLKELVLHYQHASLVQHNDALTVTLAHPVRAPGPG
PPPATR
Download sequence
Identical sequences E2RH85
ENSCAFP00000022072 9615.ENSCAFP00000022072 XP_852406.2.84170 ENSCAFP00000022072

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]