SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000022073 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000022073
Domain Number 1 Region: 182-329
Classification Level Classification E-value
Superfamily Cyclin-like 1.56e-76
Family Cyclin 0.000000664
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000022073   Gene: ENSCAFG00000014996   Transcript: ENSCAFT00000023780
Sequence length 370
Comment pep:known_by_projection chromosome:CanFam3.1:37:25529151:25530263:1 gene:ENSCAFG00000014996 transcript:ENSCAFT00000023780 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGTVLSLSPASSAKGRRPGGLPEEKKKAPPVGDEALGGYGAPPAGKGGKGESRLKRPSVL
ISALTWKRLVAASAKKKKGSKKVTPKPASTGPDPLVQQRNRENLLRKGRDPPDGGGATKP
LAVPVPTVPAAAATCEPPSGGSAAAPPPGSGGGKPPPPPPPAQQAAPPVPGGSPRRVIMQ
ASTGELLRCLGDFVCRRCYRLKELSPGELVGWFRGVDRSLLLQGWQDQAFITPANLVFVY
LLCRESLRGDELASAAELQAAFLTCLYLAYSYMGNEISYPLKPFLVEPDKERFWQRCLRL
IQRLSPQMLRLNADPHFFTQVFQDLKNEGEAAAGAGGPPSGGAPAAPAAASAARDSCATG
AKHWTMNLDR
Download sequence
Identical sequences E2RH84
ENSCAFP00000022073 XP_005640725.1.84170 ENSCAFP00000022073

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]