SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000022147 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000022147
Domain Number 1 Region: 15-146
Classification Level Classification E-value
Superfamily PH domain-like 3.96e-27
Family Phosphotyrosine-binding domain (PTB) 0.0091
Further Details:      
 
Domain Number 2 Region: 273-390
Classification Level Classification E-value
Superfamily SH2 domain 0.0000000000000152
Family SH2 domain 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000022147   Gene: ENSCAFG00000015033   Transcript: ENSCAFT00000023857
Sequence length 428
Comment pep:known_by_projection chromosome:CanFam3.1:2:78212030:78224596:1 gene:ENSCAFG00000015033 transcript:ENSCAFT00000023857 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQRPGAGGRRASDCGPAPHRPRCITKFAQYVGSFPVDDLDTQEGVWLVQQQLWALKDYPR
RRAVILKFSLQGLKIYSGEGEVLLMAHALRRILYSTWCPADCQFAFMARNPQSPASKLFC
HLFVGSQPGEVQILHLLLCRSFQLAYLLQHPEERAQPEPSLGAAGDMPLKPQPSPGGPSG
LVREPFSRDQLSQNVPALVSFRRLPAEGPVGSGKELPESEGRGGARHARLGNPYCSPTLV
RKKAIRSKVIRSGAYRGCTYETQLQLSAREAFPAAWEAWPRGPGGRACLVENEGSLTENI
WAFAGISRPSALALLRRDVLGAFLLWPEPGASGQWCLSVRTQCGVVPHQVFRNHLGRYCV
EHLPAEFASLEALVEHHAGTERSLFCSLDMGRLNPSYEEQDCGSEGRPPRTLRPLGHAKS
EAELQGLG
Download sequence
Identical sequences E2RCJ2
ENSCAFP00000022147 ENSCAFP00000022147 XP_013966368.1.84170

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]