SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000022205 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSCAFP00000022205
Domain Number - Region: 69-174
Classification Level Classification E-value
Superfamily Cyclin-like 0.000558
Family Cyclin 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000022205   Gene: ENSCAFG00000023507   Transcript: ENSCAFT00000023920
Sequence length 411
Comment pep:known chromosome:CanFam3.1:37:25729888:25735152:-1 gene:ENSCAFG00000023507 transcript:ENSCAFT00000023920 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDLAGLLRDEEGTFCLTGFQDFTFLPGHQKLSARIRRRLYYGWDWEADCSLEELSSPVAD
IAVELLQKAAPSPIRRLQKKYVAHVSREACISPCAMMLALVYIERLRHRNPGYLQHVSSS
DLFLISMMVASKYLYDEGEEEEVFNDEWGAAGGVAVPTLNALERGFLSAMDWRLYTDPRE
IFEVLSWLESCVAEQQGRRRGWYTYTDLCVLLEQPAWQLALGSLCQRLAKLSCLLAMAYV
SSVALAVASVAVIHQSLGLSCSPSPGPPDLGLVSRCLLEPCLPSSVPQCLPRPVNVSSCL
DGDTGLRSLWGSLLASLTPPPLPPPDPPAPPTLLHNCPLCQKLQRDTPSCHACHHSNHTV
PTGPPNPGYHSRNLAPPWPWSPMLPLLPQPQQCSLFSVMELARLKSFIFPG
Download sequence
Identical sequences E2RMW0
9615.ENSCAFP00000022205 ENSCAFP00000022205 XP_003640242.1.84170 XP_005640735.1.84170 XP_005640738.1.84170 XP_013966525.1.84170 XP_013966526.1.84170 XP_013966527.1.84170 XP_013966528.1.84170 XP_013966529.1.84170 ENSCAFP00000022205

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]