SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000022374 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000022374
Domain Number 1 Region: 819-1097
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 8.09e-70
Family Protein kinases, catalytic subunit 0.00000643
Further Details:      
 
Domain Number 2 Region: 509-789
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.81e-43
Family Protein kinases, catalytic subunit 0.00017
Further Details:      
 
Domain Number 3 Region: 374-477,514-538
Classification Level Classification E-value
Superfamily SH2 domain 0.00000000000000225
Family SH2 domain 0.0029
Further Details:      
 
Domain Number 4 Region: 266-362
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000123
Family Third domain of FERM 0.016
Further Details:      
 
Weak hits

Sequence:  ENSCAFP00000022374
Domain Number - Region: 125-224
Classification Level Classification E-value
Superfamily Second domain of FERM 0.046
Family Second domain of FERM 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000022374   Gene: ENSCAFG00000015159   Transcript: ENSCAFT00000024100
Sequence length 1122
Comment pep:known_by_projection chromosome:CanFam3.1:20:45053336:45067483:1 gene:ENSCAFG00000015159 transcript:ENSCAFT00000024100 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPPSEETPLIPQRSCSLSSSEAGALHVLLPPRGPGPPQRLSFSFGDHSAEELCVWAAKA
SGILPVYHSLFALATEDLSCWFPPSHIFSMEDSGTQVLVYRLRFYFPNWFGLEKCHRFGL
RKDLASAILDLPVLEHLFAQHRNDLVSGRFSVGLSLKEQDEYLSLAVLDLARMAREQAQQ
PEELLKTVSYKVCLPPDLRDLIQGLSFVTRKRIRRMVRRALRRVTACQADRHSLMAKYIM
DLERLDPARAVETFLVSFPGAAGGQDAQGLLRVAGDRGIAWSPGGQEALQPFCDFPEIVD
ISIKQAPRAGPAGEHRLVTVTKTDKQILEAEFPGLPAALSFVALVDGYFRLTSDSRHFFC
KEVAPPRLLEEVAEQCHGPITLDFAINKLKTGGSLPGSYVLRRSPQDFDSFLLTVCVQTP
LGPDYKGCLIRCDPTGTFSLAGLGRPHSSLRELLTACWDGGLHMDGAALNLTFCCTPRPK
EKSNLIVVRRGCNPPTSSPVQPQSQCQLSQMTFHKIPADSLEWHENLGHGSFTKIYRGCR
HEVVDGEARETEVLLKVMDAKHKNCMESFLEAASLMSQVSYQHLVLLHGVCMAGDSIMVQ
EFVHLGALDTYLRKSGHLVPASWKLQVIKQLAYALNYLEDKGLLHGNVSARKVLLAREGA
DGNLPFIKLSDPGVSPTVLSLEMLTDRIPWVAPECFQEARTLGLEADKWGFGATVWEVFS
GIPMPISTLDPAKKLQFYEERQQLPAPKWMELAVLIQQCMAYEPGQRPSFRAIIRDLNSL
ITSDYELLSDPTPGALAPRDGLWNGAQLYAYQDPTIFEERHLKYISQLGKGNFGSVELCR
YDPLGDNTGALVAVKQLQHSGPDQQRDFQREIQILKALHSDFIVKYRGVSYGPGRQSLRL
VMEYLPSGCLRDFLQRHRARLDAGRLLLYASQICKGMEYLGSCRCVHRDLAARNILVESE
THVKIADFGLAKLLPLDKDYYVVRGPGQNPIFWYSPESLSDNIFSCQSDVWSFGVVLYEL
FTYGNKSCSPSAEFLRIMGCERDVPALCRLVELLAEGQRLPAPPACPGEVHELMKLCWAP
SPKDRPTFSALGPQLDALWRGVAYCSTDSPPHPWGEADIAFG
Download sequence
Identical sequences E2RG40
ENSCAFP00000041505 ENSCAFP00000022374

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]