SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000022410 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000022410
Domain Number 1 Region: 152-373
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 3.66e-52
Family DBL homology domain (DH-domain) 0.00022
Further Details:      
 
Domain Number 2 Region: 376-508
Classification Level Classification E-value
Superfamily PH domain-like 1.76e-23
Family Pleckstrin-homology domain (PH domain) 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000022410   Gene: ENSCAFG00000015203   Transcript: ENSCAFT00000024139
Sequence length 788
Comment pep:known_by_projection chromosome:CanFam3.1:27:38655318:38669417:-1 gene:ENSCAFG00000015203 transcript:ENSCAFT00000024139 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQTFAPSDESPFRGLVASRIETYGGRHQASNQSFPGGPYFRGGPGLDPSGRRLQGYVPFA
KGSGHVRSVSPLKLREPEPEKKHGGHFGAGPPHSPKVKEVTNAHQLEMRLHTFSMFGMPR
LPPEDRRYWEIGEGSDNGLVIEKSWKELVPGHKEMSRELCHQQEAIWELLTTELTYVRKL
KIMTDLLVSGLLNLQRVELLTEVSAETLFGNIPSLIRVHKSFWEEVLGPTLEETRTSGRP
LDPVSLQNGFLTFSQRFQPYVQYCLQVKRTMAYAREQQDNNPLFHAFVQWCEKHKRSGRQ
MLGDLLIKPHQRITKYPLLLQAVLKRSPEAHAREALNTMIAAVESFLRHINQQVRQGEEQ
ESLVAAAQRIGPYEVLEPSSEEVEKNLRPFCTLDLMSPMLGVASEHIRQLLLEGPVRVKE
GREGKLDVYLFLFSDVLLVTKPQRKADRAKVIRPPLMLEKLVCQPLRDPNSFLVIHLTDF
QCVSSAFIVHCPSATDCAQWLKKTQQAQATLQKLKAEEYVQQKRELLALYRDQDQPSSPS
PPSPPSPEGSQSSAEGRTPEFSTIIPQLVVTEDTDEDSPSVPDDTSDSGYGTLISGSPKG
PHYVSRLRPQALRRDPRLTFSTLDLRDVPLRPRPANPQAPQRRSAPELPRQVIRRGSSLP
RGDTPTWSEEEDGTSVGGNVVVETLHRAQLWGQHPPSPTHTDSAGESPWESSGDEEEVSH
FVGPDCTPSPRPLRAEDMLREIREELASQRIEGLQEPGNSRPRKLTRGQLQRMRGPYIIQ
LDTPLSTS
Download sequence
Identical sequences F1PNA8
ENSCAFP00000022410

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]