SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000022517 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000022517
Domain Number 1 Region: 98-493
Classification Level Classification E-value
Superfamily Serpins 9.3e-124
Family Serpins 0.00000000000134
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000022517   Gene: ENSCAFG00000015271   Transcript: ENSCAFT00000024253
Sequence length 496
Comment pep:known_by_projection chromosome:CanFam3.1:26:30686726:30693698:-1 gene:ENSCAFG00000015271 transcript:ENSCAFT00000024253 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKCLFQPLIISLILTSMCANNSLAGQLEEGGEDSPSRDSQWRQLNSKNLSMSLLPADFHK
ENTVTNDWITEGEEDEDYLDLEKIFSEDDDYIDIIDAVSPTDSEAVAGNILQLFQGKSRI
QRLNILNAKFAFNLYRALKEQAHSTDNIFIAPVGISTAMGMISFGLQGETYEQVHSILHF
KDFVNASSKYEIMTIHNLFRKLTHRLFRRNFGYTLRSVNDLYVQKQFPILDDFKRKVREY
YFAEAQEADFSDPAFISKTNNHILKLTKGLIKDALENIDPATQMMILNCIYFKGSWVNKF
PVEMTHNHNFRLNEREAVKVSMMQTKGNFLAANDQELDCDILQLEYVGGISMLIVVPHKL
SGMKTLEAQLTPQVVERWQKSMTNRTREVLLPKFKLEKNYNLVEALKSMGVTALFDKESN
MTGISDHRITIDLFKHQGTITVNEEGTQAAAVTTVGFMPLSTQVRFTVDRPFLFLVYEHR
TSCLLFMGRVANPTKS
Download sequence
Identical sequences E2RLN1
XP_003433491.1.84170 9615.ENSCAFP00000022517 ENSCAFP00000022517 ENSCAFP00000022517

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]