SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000022578 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000022578
Domain Number 1 Region: 323-425,584-680
Classification Level Classification E-value
Superfamily RNI-like 9.42e-25
Family Cyclin A/CDK2-associated p19, Skp2 0.047
Further Details:      
 
Domain Number 2 Region: 200-293
Classification Level Classification E-value
Superfamily F-box domain 3.27e-19
Family F-box domain 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000022578   Gene: ENSCAFG00000015321   Transcript: ENSCAFT00000024321
Sequence length 691
Comment pep:known_by_projection chromosome:CanFam3.1:3:64684582:64726439:1 gene:ENSCAFG00000015321 transcript:ENSCAFT00000024321 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPFPEEVDVFTAPHWRMNQLVGLYWDKLSKTNFSNNNDFRALLQSLYATFKEFKMHEQI
ENEYIIGLLQQRSQTIYNVHSDNKLSEMLSLFEKGLKNVKNECEQLNYAKQLKERLEAFT
RDFLPHMKEEEEVFQPMLMEYFTYEELKDIKKKVIAQHCSQKDTAELLRGLSLWNQAEER
QKFFKYSVDEKSDKEAEVSEQSTGITHLPPEVMLSIFSYLNPQELCRCSQVSTKWSQLAK
TGSLWKHLYPVHWARGDWYSGPATELDTEPDEEWVKNRKDESRAFQEWDEDADIDESEES
AEESIAISIAQMEKRLLHGLIHNILPYVGTSVKTIVLAYSSAVSSKMVRQILELCPNLEH
LDLTQTDISDSAFDSWSWLGCCQSLRHLDLSGCEKITDVALEKISRALGILTSYQSGLLK
TSTSKITSTSWKNKDITMQSTKQYACLHDLTNKGIGEEMDNEHPWTKPVSSESFTSPYVW
MLDAEDLADIEDAVEWRHRNVESLCVMETASNFSCSSSGCYSKDIVGLRTSVCWQQHCAS
PAFAYCGHSFCCTGTALRTMSALPESSALCKKASRTRLLRGKDLIYSGSEKSDQETGRVL
LFLSLSGCYQITDHGLRVLTLGGGLPYLEHLNLSGCLTVTGAGLQDLVSACPSLNDEYFY
YCDNINGPHADTASGCQNLQCGFRACCRSGE
Download sequence
Identical sequences F1PJX0
ENSCAFP00000022578 ENSCAFP00000022578 XP_536232.2.84170

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]