SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000022653 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000022653
Domain Number 1 Region: 327-584
Classification Level Classification E-value
Superfamily p53-like transcription factors 8.08e-98
Family STAT DNA-binding domain 0.0000735
Further Details:      
 
Domain Number 2 Region: 136-332
Classification Level Classification E-value
Superfamily STAT 1.96e-54
Family STAT 0.00016
Further Details:      
 
Domain Number 3 Region: 1-124
Classification Level Classification E-value
Superfamily Transcription factor STAT-4 N-domain 1.57e-39
Family Transcription factor STAT-4 N-domain 0.00029
Further Details:      
 
Domain Number 4 Region: 587-702
Classification Level Classification E-value
Superfamily SH2 domain 4.98e-34
Family SH2 domain 0.00022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000022653   Gene: ENSCAFG00000015346   Transcript: ENSCAFT00000024404
Sequence length 794
Comment pep:known chromosome:CanFam3.1:9:20616452:20637210:-1 gene:ENSCAFG00000015346 transcript:ENSCAFT00000024404 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGWIQAQQLQGDALRQMQVLYGQHFPIEVRHYLAQWIESQPWDAIDLDNPQDRAQATQL
LEGLVQELQKKAEHQVGEDGFLLKIKLGHYASQLQNTYDGCPMELVRCIRHILYNEQRLV
REANNGNSPAGILVDAMSQKHLQINQTFEELRLVTQDTENELKKLQQTQEYFIIQYQESL
RIQAQFSQLAQLNPQERLSRETALQQKQVSLEAWLQREAQTLQQYRVELAEKHQKTLQLL
RKQQTIILDDELIQWKRRQQLAGNGGPPEGSLDVLQSWCEKLAEIIWQNRQQIRRAEHLC
QQLPIPGPVEEMLAEVNATITDIISALVTSTFIIEKQPPQVLKTQTKFAATVRLLVGGKL
NVHMNPPQVKATIISEQQAKSLLKNENARNECSGEILNNCCVMEYHQATCTLSAHFRNMS
LKRIKRADRRGAESVTEEKFTVLFESQFSVGSNELVFQVKTLSLPVVVIVHGSQDHNATA
TVLWDNAFAEPGRVPFAVPDKVLWPQLCEALNMKFKAEVQSNRGLTKENLVFLAQKLFNS
SSSHLEDYNGMSVSWSQFNRENLPGWNYTFWQWFDGVMEVLKKHHKPHWNDGAILGFVNK
QQAHDLLINKPDGTFLLRFSDSEIGGITIAWKFDSPDRNLWNLKPFTTRDFSIRSLADRL
GDLNYLIYVFPDRPKDEVFSKYYTPVFAKAVDGYVKPQIKQVVPEFVSASTDSAGASATY
MDQAPSPAVCPQAHYNMYPQNPDSVLDQDGEFDLDETMDVARHVEELLRRPMDSLDPRLS
PPAGLFTAARGSLS
Download sequence
Identical sequences E2RE22
ENSCAFP00000022653 XP_548091.2.84170 ENSCAFP00000022653

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]