SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000022654 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000022654
Domain Number 1 Region: 51-184
Classification Level Classification E-value
Superfamily Cyclin-like 1.78e-44
Family Cyclin 0.00023
Further Details:      
 
Domain Number 2 Region: 186-287
Classification Level Classification E-value
Superfamily Cyclin-like 4.33e-27
Family Cyclin 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000022654   Gene: ENSCAFG00000015381   Transcript: ENSCAFT00000024405
Sequence length 322
Comment pep:known_by_projection chromosome:CanFam3.1:27:40567736:40594271:-1 gene:ENSCAFG00000015381 transcript:ENSCAFT00000024405 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQGRGSGFFLRGRGPRKNRCPEKAGERAGTRLAMELLCCEVDPVRRAVPDANLLYDDRVL
QNLLTIEERYLPQCSYFKCVQKDIQPYMRRMVATWMLEVCEEQKCEEEVFPLAMNYLDRF
LAGVPTPKTHLQLLGAVCMFLASKLKETIPLTAEKLCIYTDNSIKPQELLEWELVVLGKL
KWNLAAVTPHDFIEHILRKLPQPSEKLSLIRKHAQTFIALCATDFKFAMYPPSMIATGSV
GAAICGLQQDEDVSSLTGDALVDLLAKITNTDVDCLKACQEQIEVVLLNSLQQFRQDQGD
GSKSEDELDQASTPTDVRDIDL
Download sequence
Identical sequences F1PWA3
ENSCAFP00000022654 ENSCAFP00000022654

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]