SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000022761 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000022761
Domain Number 1 Region: 284-410
Classification Level Classification E-value
Superfamily SH2 domain 6.06e-24
Family SH2 domain 0.00094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000022761   Gene: ENSCAFG00000015458   Transcript: ENSCAFT00000024519
Sequence length 428
Comment pep:known_by_projection chromosome:CanFam3.1:3:69001224:69080263:1 gene:ENSCAFG00000015458 transcript:ENSCAFT00000024519 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FHPRGNRRTTKEGSSDMKFQNLCLPKNRSWPRFNSATGQYRTIDEPLLHCERNSAAAVLG
RDKDQNDDDYEDPELHMVEAWQPIKILPARPIKESEYADTRYFKSAMDTPLSLDTKTSVP
MEHHHWHTQMGLGKVDEPISKDSRNQHVKEVSSKNKNKTPLPPPRPPVTLPKKYQPLPPQ
PESSWSPPPQRLSFPEVQKGPRQISLKDLSEVLGTERVPHYQMKPESIHLSQTQSIPEIP
LVTASSPFMMRNHSVQNRDHKESMQFHPQRCQSPARYSPQENLLHYKNTSWRKPSPTSSD
EKDVQNNDWYIGEHSRQAVEEALRKENKDGTFLVRDCSTKSRAEPYVLVVFYGNKVYNVK
IRFLEKNQQFALGTGLRGDEKFNSVEDIIEHYKYFPIILIDGKDKTGIHKEQCYLTQPLP
LSRCFSPW
Download sequence
Identical sequences F1PT39
9615.ENSCAFP00000022761 ENSCAFP00000022761 ENSCAFP00000022761

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]